| Clone Name | bart33h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CORA_HPBGS (P03153) Core antigen | 30 | 5.9 | 2 | CORA_WHV2 (P06433) Core antigen | 29 | 7.7 | 3 | CORA_WHV8 (P69711) Core antigen | 29 | 7.7 | 4 | CORA_WHV7 (P69710) Core antigen | 29 | 7.7 | 5 | CORA_WHV59 (P69712) Core antigen | 29 | 7.7 | 6 | CORA_WHV1 (P69709) Core antigen | 29 | 7.7 | 7 | GLCA_SOYBN (P13916) Beta-conglycinin, alpha chain precursor | 29 | 10.0 | 8 | MDR_PLAFF (P13568) Multidrug resistance protein (EC 3.6.3.44) (C... | 29 | 10.0 |
|---|
>CORA_HPBGS (P03153) Core antigen| Length = 217 Score = 29.6 bits (65), Expect = 5.9 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = -3 Query: 361 MYEDTIR-RQHSKPHEMAPMMSRLCWDRI-----W*SRSCSTSLDRVII 233 +YE+ + R+H PH A + +CW+ + W S + + + R+I+ Sbjct: 67 LYEEELTGREHCSPHHTAIRQALVCWEELTRLITWMSENTTEEVRRIIV 115
>CORA_WHV2 (P06433) Core antigen| Length = 187 Score = 29.3 bits (64), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -3 Query: 361 MYEDTIR-RQHSKPHEMAPMMSRLCWDRI-----W*SRSCSTSLDRVII 233 +YE+ + R+H PH A + +CWD + W S + ++ R II Sbjct: 37 LYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTII 85
>CORA_WHV8 (P69711) Core antigen| Length = 188 Score = 29.3 bits (64), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -3 Query: 361 MYEDTIR-RQHSKPHEMAPMMSRLCWDRI-----W*SRSCSTSLDRVII 233 +YE+ + R+H PH A + +CWD + W S + ++ R II Sbjct: 37 LYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTII 85
>CORA_WHV7 (P69710) Core antigen| Length = 188 Score = 29.3 bits (64), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -3 Query: 361 MYEDTIR-RQHSKPHEMAPMMSRLCWDRI-----W*SRSCSTSLDRVII 233 +YE+ + R+H PH A + +CWD + W S + ++ R II Sbjct: 37 LYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTII 85
>CORA_WHV59 (P69712) Core antigen| Length = 188 Score = 29.3 bits (64), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -3 Query: 361 MYEDTIR-RQHSKPHEMAPMMSRLCWDRI-----W*SRSCSTSLDRVII 233 +YE+ + R+H PH A + +CWD + W S + ++ R II Sbjct: 37 LYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTII 85
>CORA_WHV1 (P69709) Core antigen| Length = 188 Score = 29.3 bits (64), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -3 Query: 361 MYEDTIR-RQHSKPHEMAPMMSRLCWDRI-----W*SRSCSTSLDRVII 233 +YE+ + R+H PH A + +CWD + W S + ++ R II Sbjct: 37 LYEEELTGREHCSPHHTAIRQALVCWDELTKLIAWMSSNITSEQVRTII 85
>GLCA_SOYBN (P13916) Beta-conglycinin, alpha chain precursor| Length = 605 Score = 28.9 bits (63), Expect = 10.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 96 WAWKKKKRGEKSLQEEDEE 40 W K++KRGEK +EEDE+ Sbjct: 125 WPRKEEKRGEKGSEEEDED 143
>MDR_PLAFF (P13568) Multidrug resistance protein (EC 3.6.3.44) (Chloroquine| resistance protein) Length = 1419 Score = 28.9 bits (63), Expect = 10.0 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 252 LVEQLRDYQIRSQHKRDIIGAISWGL-LCCLLIVSSYMMLYFRHFWLSAVIISVGILL 422 L+E+ DY+ + Q +R I+ A WG L ++S+ +W + +I G +L Sbjct: 1008 LIEKAIDYKNKGQKRRIIVNAALWGFSQSAQLFINSFA------YWFGSFLIKRGTIL 1059 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,221,042 Number of Sequences: 219361 Number of extensions: 849446 Number of successful extensions: 3339 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3339 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)