| Clone Name | bart32d04 |
|---|---|
| Clone Library Name | barley_pub |
>CTPA_MYCTU (Q10876) Cation-transporting P-type ATPase A (EC 3.6.3.-)| Length = 761 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +3 Query: 330 QTVELKVR-MCCSGCARVVKHALTKLRGXXXXXXXXXXXXXXXTG-YVERHRVLKEVRRA 503 Q ++L++ M CS CA V+ L KL G T V+ + + VRRA Sbjct: 14 QRIQLRISGMSCSACAHRVESTLNKLPGVRAAVNFGTRVATIDTSEAVDAAALCQAVRRA 73 Query: 504 GKKAE 518 G +A+ Sbjct: 74 GYQAD 78
>MERP_SALTI (P0A216) Mercuric transport protein periplasmic component precursor| (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) Length = 91 Score = 29.3 bits (64), Expect = 9.4 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 330 QTVELKVR-MCCSGCARVVKHALTKLRG 410 QTV L V M C+ C VKHAL+K+ G Sbjct: 22 QTVTLSVPGMTCASCPITVKHALSKVEG 49
>MERP_ENTCL (P0A218) Mercuric transport protein periplasmic component precursor| (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) Length = 91 Score = 29.3 bits (64), Expect = 9.4 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 330 QTVELKVR-MCCSGCARVVKHALTKLRG 410 QTV L V M C+ C VKHAL+K+ G Sbjct: 22 QTVTLSVPGMTCASCPITVKHALSKVEG 49
>MERP_ENTAG (P0A217) Mercuric transport protein periplasmic component precursor| (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) Length = 91 Score = 29.3 bits (64), Expect = 9.4 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 330 QTVELKVR-MCCSGCARVVKHALTKLRG 410 QTV L V M C+ C VKHAL+K+ G Sbjct: 22 QTVTLSVPGMTCASCPITVKHALSKVEG 49
>MERP_ACICA (Q52107) Mercuric transport protein periplasmic component precursor| (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) Length = 91 Score = 29.3 bits (64), Expect = 9.4 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 330 QTVELKVR-MCCSGCARVVKHALTKLRG 410 QTV L V M C+ C VKHAL+K+ G Sbjct: 22 QTVTLSVPGMTCASCPITVKHALSKVEG 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,489,948 Number of Sequences: 219361 Number of extensions: 496077 Number of successful extensions: 1818 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1816 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)