| Clone Name | bart32c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BCHG_CHLAU (P33326) Bacteriochlorophyll synthase 34 kDa chain | 59 | 9e-09 | 2 | BCHG_RHOCA (P26170) Bacteriochlorophyll synthase 33 kDa chain (G... | 50 | 3e-06 | 3 | BCHG_RHOS4 (Q9Z5D6) Bacteriochlorophyll synthase 33 kDa chain (G... | 47 | 4e-05 | 4 | AGRN_DISOM (Q90404) Agrin (Fragment) | 29 | 7.8 |
|---|
>BCHG_CHLAU (P33326) Bacteriochlorophyll synthase 34 kDa chain| Length = 310 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/62 (43%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Frame = +3 Query: 309 WKIR-LQLTKPVTWPPLVWGVLCGAAASGNFHWTVEDVAKSIVCMLMSGPCLTGYTQTIN 485 W +R +QL KPVTW W +CGA ASG W E + + ++ M M+GP L G +Q +N Sbjct: 28 WLVRSIQLMKPVTWFAPTWAFMCGAIASGALGWN-ESIGRLLLGMFMAGPILCGLSQVVN 86 Query: 486 DW 491 D+ Sbjct: 87 DY 88
>BCHG_RHOCA (P26170) Bacteriochlorophyll synthase 33 kDa chain (Geranylgeranyl| bacteriochlorophyll synthase) Length = 304 Score = 50.4 bits (119), Expect = 3e-06 Identities = 23/57 (40%), Positives = 35/57 (61%) Frame = +3 Query: 321 LQLTKPVTWPPLVWGVLCGAAASGNFHWTVEDVAKSIVCMLMSGPCLTGYTQTINDW 491 L+L KPVTW P +W LCGA +S W E+ ++ ++++GP + G +Q NDW Sbjct: 20 LELIKPVTWFPPMWAYLCGAVSSNVPIW--ENKGVVVLGIVLAGPIVCGMSQAANDW 74
>BCHG_RHOS4 (Q9Z5D6) Bacteriochlorophyll synthase 33 kDa chain (Geranylgeranyl| bacteriochlorophyll synthase) Length = 302 Score = 46.6 bits (109), Expect = 4e-05 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +3 Query: 321 LQLTKPVTWPPLVWGVLCGAAASGNFHWTVEDVAKSIVCMLMSGPCLTGYTQTINDW 491 L+L +P+TW P +W LCG + G W E ++ M+++GP + G +Q N+W Sbjct: 19 LELIQPITWFPPIWAYLCGTVSVG--IWPGEKWPLVLLGMVLAGPLVCGMSQAANNW 73
>AGRN_DISOM (Q90404) Agrin (Fragment)| Length = 1328 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -3 Query: 416 IFNCPV--EISGGSCSTKHSPDKRRPCH 339 +F+C E SG +C+ KH+P PCH Sbjct: 848 MFHCESVGEFSGPTCADKHNPCDPNPCH 875 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,580,692 Number of Sequences: 219361 Number of extensions: 954959 Number of successful extensions: 2628 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2625 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)