| Clone Name | bart32a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAG2_ONCMY (Q91193) V(D)J recombination-activating protein 2 (RA... | 31 | 2.4 | 2 | VG42_BPMU (Q9T1V6) Protein gp42 | 29 | 9.2 |
|---|
>RAG2_ONCMY (Q91193) V(D)J recombination-activating protein 2 (RAG-2)| Length = 533 Score = 31.2 bits (69), Expect = 2.4 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -1 Query: 596 GRRAYGEESAHERVHGLGQRGAAEAADAECQERELVREAPPPR 468 GR E S+ + L RG CQERELV E P PR Sbjct: 95 GRTPNNEISSSLYLLTLDSRGCNRKVTLRCQERELVGEQPGPR 137
>VG42_BPMU (Q9T1V6) Protein gp42| Length = 690 Score = 29.3 bits (64), Expect = 9.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 170 GVGSIHPSIWPRDVSDLPAGGGKRSEVGRRLGRISPLV 283 G+ + WPR D +GGG+R G GR++PL+ Sbjct: 416 GIQRVFVINWPRGFGDYGSGGGRRVRSG---GRMAPLL 450 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,429,702 Number of Sequences: 219361 Number of extensions: 1329676 Number of successful extensions: 3368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3366 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)