ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bart29h03 |
|---|---|
| Clone Library Name | barley_pub |
>SIN3A_HUMAN (Q96ST3) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1273 Score = 32.7 bits (73), Expect = 0.56 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 236 QPPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAP 400 Q PS SA + APQPP ++ ++ + P + PP+ P SPR+P Sbjct: 225 QHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPL-PPYASPRSP 278
>TRBM_MOUSE (P15306) Thrombomodulin precursor (TM) (Fetomodulin) (CD141| antigen) Length = 577 Score = 32.3 bits (72), Expect = 0.73 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 332 DVKQPEADVEPPVTPTKGSPRAP 400 D K+ E EPPV+PT GSP P Sbjct: 487 DTKEEEGSGEPPVSPTPGSPTGP 509
>IF2_SYNEL (Q8DK04) Translation initiation factor IF-2| Length = 957 Score = 32.0 bits (71), Expect = 0.95 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 14/74 (18%) Frame = +2 Query: 224 ARSYQPPSWNRESSARWS--VEAAPQP------------PSSRWNRAADNDVKQPEADVE 361 A++YQP S + ++ S V+ AP P P S A +++P A + Sbjct: 52 AKTYQPHSASPRKVSKTSPPVKKAPAPQKTQQIVAVHTQPRSETPEAPKPQLQKPPARPQ 111 Query: 362 PPVTPTKGSPRAPL 403 PP PT+ +P AP+ Sbjct: 112 PPQAPTRPTPPAPV 125
>SIN3A_MOUSE (Q60520) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1282 Score = 31.2 bits (69), Expect = 1.6 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +2 Query: 236 QPPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAP 400 Q PS SA + APQP +++ ++ + P + PP+ P SPR+P Sbjct: 225 QHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPL-PPYASPRSP 278
>STB1_YEAST (P42845) Protein STB1 (SIN3-binding protein 1)| Length = 420 Score = 31.2 bits (69), Expect = 1.6 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +2 Query: 278 VEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLPRRASYYYSTRDR 442 VE PPSSR +A D + + P TP + LP +S+Y D+ Sbjct: 94 VEKPNTPPSSRQRKAEDRSQQIKPRKEDTPSTPRASATPIILPHASSHYQRPHDK 148
>SGS3_DROSI (P13729) Salivary glue protein Sgs-3 precursor| Length = 217 Score = 30.4 bits (67), Expect = 2.8 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = -3 Query: 233 RTEPRRTDDAPQXXXXXXXXXXXXXRTMRWVSCRTAGTCGEPCALAGRRCALC 75 +T+P + T + C++ G GEPC G+R ALC Sbjct: 139 KTKPTKHTTPKTKPTKHTTPTTTTTTTPKPCGCKSCGPGGEPCKGCGKRSALC 191
>WASIP_HUMAN (O43516) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) (PRPL-2 protein) Length = 503 Score = 30.0 bits (66), Expect = 3.6 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +2 Query: 239 PPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLP 406 PP +R S ++ A PQ PS + V P + PP+ P + S AP P Sbjct: 382 PPPVSRNGSTSRALPATPQLPSR-------SGVDSPRSGPRPPLPPDRPSAGAPPP 430
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 26.2 bits (56), Expect(2) = 4.5 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = +2 Query: 227 RSYQPPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLP 406 RS P R SSA S ++ SS +R+ K P+ PP + SP A P Sbjct: 338 RSRSPGRRRRRSSASLSGSSS----SSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPP 393 Query: 407 RR 412 RR Sbjct: 394 RR 395 Score = 21.9 bits (45), Expect(2) = 4.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 40 STSPPRTVVQSEQSAHRRPARAHGS 114 S S R+ +S +H RP R H S Sbjct: 278 SRSKSRSRTRSRSPSHTRPRRRHRS 302
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 26.2 bits (56), Expect(2) = 4.6 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = +2 Query: 227 RSYQPPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLP 406 RS P R SSA S ++ SS +R+ K P+ PP + SP A P Sbjct: 340 RSRSPVRRRRRSSASLSGSSS----SSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPP 395 Query: 407 RR 412 RR Sbjct: 396 RR 397 Score = 21.9 bits (45), Expect(2) = 4.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 40 STSPPRTVVQSEQSAHRRPARAHGS 114 S S R+ +S +H RP R H S Sbjct: 280 SRSKSRSRTRSRSPSHTRPRRRHRS 304
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 26.2 bits (56), Expect(2) = 4.6 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = +2 Query: 227 RSYQPPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLP 406 RS P R SSA S ++ SS +R+ K P+ PP + SP A P Sbjct: 340 RSRSPVRRRRRSSASLSGSSS----SSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPP 395 Query: 407 RR 412 RR Sbjct: 396 RR 397 Score = 21.9 bits (45), Expect(2) = 4.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 40 STSPPRTVVQSEQSAHRRPARAHGS 114 S S R+ +S +H RP R H S Sbjct: 280 SRSKSRSRTRSRSPSHTRPRRRHRS 304
>FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 481 Score = 29.6 bits (65), Expect = 4.7 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +2 Query: 287 APQPPSSRWNRAADNDVKQPEADVEPPVTPTKGS 388 APQPP +R AAD+D K P+ + PP T G+ Sbjct: 79 APQPPQARGAPAADDD-KGPQPLLLPPSTALDGA 111
>HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)| Length = 3969 Score = 29.6 bits (65), Expect = 4.7 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = +2 Query: 230 SYQPPSWNRESSARWSVEAAPQPPSSRW----NRAADNDVKQPEADVEPPVTPTKGSPRA 397 S PP E + +AP P S + +R + V QP A V PP PT G PR Sbjct: 1259 SEPPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQP-ALVIPPQPPTTGPPRK 1317 Query: 398 PLPR 409 +P+ Sbjct: 1318 EVPK 1321
>KCNH3_RAT (O89047) Potassium voltage-gated channel subfamily H member 3| (Voltage-gated potassium channel subunit Kv12.2) (Ether-a-go-go-like potassium channel 2) (ELK channel 2) (rElk2) (Brain-specific eag-like channel 1) (BEC1) Length = 1087 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = -3 Query: 500 PAMARPWPWAASEPAAQGPP-----CLWWSSSTTPCEGAG 396 P + PWPW PA+Q P LW S+S + G+G Sbjct: 973 PPLMAPWPW--GPPASQSSPWPRATALWTSTSDSEPPGSG 1010
>KCNH3_MOUSE (Q9WVJ0) Potassium voltage-gated channel subfamily H member 3| (Voltage-gated potassium channel subunit Kv12.2) (Ether-a-go-go-like potassium channel 2) (ELK channel 2) (mElk2) Length = 1087 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = -3 Query: 500 PAMARPWPWAASEPAAQGPP-----CLWWSSSTTPCEGAG 396 P + PWPW PA+Q P LW S+S + G+G Sbjct: 973 PPLMAPWPW--GPPASQSSPWPRATALWTSTSDSEPPGSG 1010
>WASIP_MOUSE (Q8K1I7) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) Length = 493 Score = 29.3 bits (64), Expect = 6.2 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 239 PPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLP 406 PP NR S ++ A PQ PS + + P + PP+ P + AP P Sbjct: 372 PPPINRNGSTARALPATPQLPSR-------SGMDSPRSGPRPPLPPDRPGAGAPPP 420
>WASIP_RAT (Q6IN36) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) Length = 487 Score = 29.3 bits (64), Expect = 6.2 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 239 PPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLP 406 PP NR S ++ A PQ PS + + P + PP+ P + AP P Sbjct: 366 PPPINRNGSTARALPATPQLPSR-------SGMDSPRSGPRPPLPPDRPGAGAPPP 414
>IF2C_EUGGR (Q9XEK9) Translation initiation factor IF-2, chloroplast (Fragment)| Length = 822 Score = 29.3 bits (64), Expect = 6.2 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 239 PPSWNRESSARWSVEAAPQPPSSRWNRAADN-DVKQPEADVEPPVTPTKGSPRAPL 403 PP SAR V PQ S A +VK+P AD +PP TP+ R P+ Sbjct: 24 PPEAPTSPSARQPVTQVPQANSVPAGAVASQAEVKKP-ADPQPPATPSAPVLRRPV 78
>BAB2_DROME (Q9W0K4) Protein bric-a-brac 2| Length = 1067 Score = 29.3 bits (64), Expect = 6.2 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 12/77 (15%) Frame = +2 Query: 251 NRESSARWSVEAAPQPPSS-----RWNRAADNDVKQPEADVEPPVTPTKGSPR------- 394 NR+ S VE Q PS + + + +VK PE DVE + +K SP Sbjct: 52 NRKYSPEREVEPTLQDPSEVVDQMQKDTESVGEVKSPEKDVETELVKSKASPMNDQALTP 111 Query: 395 APLPRRASYYYSTRDRE 445 P P +S RD E Sbjct: 112 PPRPLTSSEVVGLRDPE 128
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 29.3 bits (64), Expect = 6.2 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Frame = +2 Query: 239 PPSWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPP------VTPTKG--SPR 394 PP +R S AP+PP SRW A+ P+ V PP +TPT G +P Sbjct: 1909 PPRRSRRPSP-----LAPRPPPSRW--ASPPLKTSPQLRVPPPTSVVTALTPTSGELAPP 1961 Query: 395 APLP 406 P P Sbjct: 1962 GPAP 1965
>APBA1_HUMAN (Q02410) Amyloid beta A4 precursor protein-binding family A member| 1 (Neuron-specific X11 protein) (Neuronal Munc18-1-interacting protein 1) (Mint-1) (Adapter protein X11alpha) Length = 837 Score = 29.3 bits (64), Expect = 6.2 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +2 Query: 245 SWNRESSARWSVEAAPQPPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAP 400 S+ +E V Q SS+ A D+ + E D+E P TP G P +P Sbjct: 263 SYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERPPTPAGGRPDSP 314
>CLIC6_HUMAN (Q96NY7) Chloride intracellular channel 6| Length = 704 Score = 28.9 bits (63), Expect = 8.1 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +1 Query: 379 EGVAPCPAPSQGVVLLLHQRQGGPCAAGSEAAQGQG 486 EGVAP P V L +R G P AAG EA +G Sbjct: 8 EGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEG 43
>NDF2_RAT (Q63689) Neurogenic differentiation factor 2 (NeuroD2) (Brain bHLH| protein KW8) Length = 382 Score = 28.9 bits (63), Expect = 8.1 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +2 Query: 296 PPSSRWNRAADNDVKQPEADVEPPVTPTKGSPRAPLPRRASYYYSTRDREV 448 P + W D++ + + D P P GS AP P RA+ S R EV Sbjct: 16 PKFASWGDGDDDEPRSDKGDAPPQPPPAPGSG-APGPARATKPVSLRGEEV 65
>SOS2_HUMAN (Q07890) Son of sevenless homolog 2 (SOS-2)| Length = 1332 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = +2 Query: 290 PQPPSSRWNRAADNDVKQPEADVEPPV------TPTKGSPRAPLPRRA 415 P PP +++ A N ++D +PP P K PR P+P A Sbjct: 1148 PLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPVPTGA 1195
>ABP1_SACEX (P38479) Actin-binding protein| Length = 617 Score = 28.9 bits (63), Expect = 8.1 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +2 Query: 281 EAAPQPPSSRWNRAADNDVKQPEADVE-----PPVTPTKGSPRAPLPRRA 415 E AP P N A + + +QP+ + E P P++GS P P+RA Sbjct: 500 EEAPAPSLPSRNAAPEPEPEQPQEEEEEEEAPAPSLPSRGSVPPPPPQRA 549 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.130 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,893,850 Number of Sequences: 219361 Number of extensions: 808333 Number of successful extensions: 3711 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 3367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3694 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)
