| Clone Name | bart29e12 |
|---|---|
| Clone Library Name | barley_pub |
>MURD_SALTY (Q8ZRU4) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 437 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 267 GSGCSARTPPCTRCLVAAKLLMYCYGRTRKQL 362 G G SA P TR L ++ +YC+GR QL Sbjct: 345 GDGKSADFSPLTRYLTGDRIRLYCFGRDGAQL 376
>MURD_SALCH (Q57TD2) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 438 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 267 GSGCSARTPPCTRCLVAAKLLMYCYGRTRKQL 362 G G SA P TR L ++ +YC+GR QL Sbjct: 346 GDGKSADFSPLTRYLTGDRIRLYCFGRDGAQL 377
>MURD_SALTI (Q8Z9H0) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 437 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 267 GSGCSARTPPCTRCLVAAKLLMYCYGRTRKQL 362 G G SA P R L ++ +YC+GR QL Sbjct: 345 GDGKSADFSPLARYLTGDRIRLYCFGRDGAQL 376
>MURD_SALPA (Q5PDC2) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 438 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 267 GSGCSARTPPCTRCLVAAKLLMYCYGRTRKQL 362 G G SA P R L ++ +YC+GR QL Sbjct: 346 GDGKSADFSPLARYLTGDRIRLYCFGRDGAQL 377
>MURD_PHOLL (Q7N145) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 436 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 267 GSGCSARTPPCTRCLVAAKLLMYCYGRTRKQL 362 G G SA P L K+ +YC+GR KQL Sbjct: 344 GDGKSADFSPLKPFLCGNKVQLYCFGRDGKQL 375
>ZMYM6_HUMAN (O95789) Zinc finger MYM-type protein 6 (Zinc finger protein 258)| Length = 723 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 342 HNSTSAVLPPPSTLCTEVSSPSSLNPRDL 256 H+S + + PPP CT S LNP+D+ Sbjct: 124 HSSPACLPPPPKKTCTNCSK-DILNPKDV 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,202,741 Number of Sequences: 219361 Number of extensions: 447487 Number of successful extensions: 1843 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1843 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)