| Clone Name | bart29d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FER_MYCTU (P64122) Ferredoxin | 32 | 1.6 | 2 | FER_MYCBO (P64123) Ferredoxin | 32 | 1.6 | 3 | DLL4_XENLA (P53775) Homeobox protein DLL-4 (XDLL-4) | 31 | 2.1 | 4 | HUTU_BACHD (Q9KBE5) Urocanate hydratase (EC 4.2.1.49) (Urocanase... | 30 | 6.2 | 5 | AINX_HUMAN (Q16352) Alpha-internexin (Alpha-Inx) (66 kDa neurofi... | 29 | 8.1 |
|---|
>FER_MYCTU (P64122) Ferredoxin| Length = 113 Score = 31.6 bits (70), Expect = 1.6 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 240 DADSRKPTCRAVIQDATLWPEAVDSDWHQHLGGNLLYTRFHVLL 371 D + KP CR +A W + D HQHLG N + FH +L Sbjct: 41 DCGACKPACRV---EAIYWEGDLPDDQHQHLGDNAAF--FHQVL 79
>FER_MYCBO (P64123) Ferredoxin| Length = 113 Score = 31.6 bits (70), Expect = 1.6 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 240 DADSRKPTCRAVIQDATLWPEAVDSDWHQHLGGNLLYTRFHVLL 371 D + KP CR +A W + D HQHLG N + FH +L Sbjct: 41 DCGACKPACRV---EAIYWEGDLPDDQHQHLGDNAAF--FHQVL 79
>DLL4_XENLA (P53775) Homeobox protein DLL-4 (XDLL-4)| Length = 285 Score = 31.2 bits (69), Expect = 2.1 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = -3 Query: 565 VPAFSQNLCHEASPAPSTCGFLALDSS------QQQHAGALHPLQSP*IHRGFEILGSYQ 404 +P+ S + H++ +P+ A DSS QQQH GA+ P + LGSYQ Sbjct: 17 MPSSSYHSLHKSQESPTLPVSTATDSSYYTNQQQQQHCGAVSP---------YGQLGSYQ 67 Query: 403 QTSSASSGI 377 +A +GI Sbjct: 68 FHGAAINGI 76
>HUTU_BACHD (Q9KBE5) Urocanate hydratase (EC 4.2.1.49) (Urocanase)| (Imidazolonepropionate hydrolase) Length = 559 Score = 29.6 bits (65), Expect = 6.2 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 130 RYPRRLTHSLPRAAGW-SCCGTSGD*LSVGVEGEAAPAH 17 +Y R+T SL +A W S G+ LS+G+ G AA H Sbjct: 207 KYTDRITESLDQALAWASEAKAKGEPLSIGLVGNAAHLH 245
>AINX_HUMAN (Q16352) Alpha-internexin (Alpha-Inx) (66 kDa neurofilament| protein) (Neurofilament-66) (NF-66) Length = 499 Score = 29.3 bits (64), Expect = 8.1 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +1 Query: 139 GGWHRCSCRSKNPRGASGRRPPGVSRSTGCSNLEMPTAESLRAELSSKTPP 291 G R S R GA G R +SRS S+ +A SL L+ + PP Sbjct: 20 GDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPP 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,840,880 Number of Sequences: 219361 Number of extensions: 1463099 Number of successful extensions: 4040 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4040 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)