| Clone Name | bart29a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7... | 30 | 2.5 | 2 | RNS2_PANGI (P80890) Ribonuclease 2 (EC 3.1.-.-) | 30 | 2.5 | 3 | RNS1_PANGI (P80889) Ribonuclease 1 (EC 3.1.-.-) | 30 | 2.5 | 4 | PRU1_PRUAR (O50001) Major allergen Pru ar 1 | 29 | 5.5 | 5 | PHF8_MOUSE (Q80TJ7) PHD finger protein 8 | 29 | 5.5 | 6 | ALL2_APIGR (P92918) Major allergen Api g 2 (Api g 1.0201) | 29 | 7.2 | 7 | PR11_PETCR (P19417) Pathogenesis-related protein A (PR1-1) | 28 | 9.4 |
|---|
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1)| (Protein kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 30.4 bits (67), Expect = 2.5 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +2 Query: 398 LDGDGG----VGTLREGARGVGPPRGVEPR 475 +DGDGG GTL E RG GP EPR Sbjct: 1 MDGDGGRRDVPGTLMEPGRGAGPAGMAEPR 30
>RNS2_PANGI (P80890) Ribonuclease 2 (EC 3.1.-.-)| Length = 153 Score = 30.4 bits (67), Expect = 2.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 359 PQAYKSFVRSCALLDGDGGVGTLREGARGVGPP 457 P+A+ ++S +L+G+GGVGT++ G P Sbjct: 31 PKAFPEGIKSVQVLEGNGGVGTIKNVTLGDATP 63
>RNS1_PANGI (P80889) Ribonuclease 1 (EC 3.1.-.-)| Length = 154 Score = 30.4 bits (67), Expect = 2.5 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +2 Query: 359 PQAYKSFVRSCALLDGDGGVGTLR 430 P+A+ ++S +++GDGGVGT++ Sbjct: 31 PKAFPQAIKSSEIIEGDGGVGTVK 54
>PRU1_PRUAR (O50001) Major allergen Pru ar 1| Length = 160 Score = 29.3 bits (64), Expect = 5.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 359 PQAYKSFVRSCALLDGDGGVGTLREGARGVG 451 P+ + V+ +L+GDGGVGT+++ G G Sbjct: 32 PKVAPTAVKGTEILEGDGGVGTIKKVTFGEG 62
>PHF8_MOUSE (Q80TJ7) PHD finger protein 8| Length = 1023 Score = 29.3 bits (64), Expect = 5.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 6 QTRPDQTNQRRTAPHPSHQTSSQPDSKRAPE 98 Q RP +N T P P+ T+ QPD+ +P+ Sbjct: 904 QPRPQDSNPIMTMPAPTVATTPQPDTSSSPQ 934
>ALL2_APIGR (P92918) Major allergen Api g 2 (Api g 1.0201)| Length = 159 Score = 28.9 bits (63), Expect = 7.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 359 PQAYKSFVRSCALLDGDGGVGTLR 430 P+ ++S +L+GDGGVGT++ Sbjct: 32 PKVLPQLIKSVEILEGDGGVGTVK 55
>PR11_PETCR (P19417) Pathogenesis-related protein A (PR1-1)| Length = 155 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 359 PQAYKSFVRSCALLDGDGGVGTLR 430 PQ ++S L+GDGGVGT++ Sbjct: 32 PQVLPGAIKSSETLEGDGGVGTVK 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.121 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,505,559 Number of Sequences: 219361 Number of extensions: 677344 Number of successful extensions: 2442 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2435 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)