| Clone Name | bart28a05 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_HCVVA (Q9QAX1) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 31.6 bits (70), Expect = 1.6 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -3 Query: 315 PGAEALDPSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 172 PG +LDP L + P+R DRR A + RPL S K Sbjct: 1118 PGTRSLDPCTCGAVDLYLVTRNADVIPARRQGDRRGALLSPRPLSSLK 1165
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 31.2 bits (69), Expect = 2.1 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -3 Query: 315 PGAEALDPSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 172 PGA +L P N ++ L + P+R D RAA + RP+ + K Sbjct: 1118 PGARSLTPCNCGSSDLYLVTREADVIPARRRGDSRAALLSPRPISTLK 1165
>POLG_HCVBB (Q68749) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3036 Score = 30.0 bits (66), Expect = 4.7 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -3 Query: 315 PGAEALDPSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 172 PG +L+P L + P+R DRR A + RPL S K Sbjct: 1118 PGTRSLEPCTCGAVDLYLVTRNADVIPARRRGDRRGALLSPRPLSSLK 1165
>POLG_HCVJP (Q9DHD6) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -3 Query: 315 PGAEALDPSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 172 PG ++LDP L + P R DRR A + RPL + K Sbjct: 1118 PGTKSLDPCTCGAVDLYLVTRNADVIPVRRKDDRRGALLSPRPLSTLK 1165
>POLG_HCVJ8 (P26661) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -3 Query: 315 PGAEALDPSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 172 PG ++LDP L + P R DRR A + RPL + K Sbjct: 1118 PGTKSLDPCTCGAVDLYLVTRNADVIPVRRKDDRRGALLSPRPLSTLK 1165
>SMI1_ASHGO (Q75AQ9) KNR4/SMI1 homolog| Length = 657 Score = 29.3 bits (64), Expect = 8.0 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +2 Query: 194 PLTLAALRSEASLEGDAWRSSPVSLADAVSKLLGSSASAPGANITASDEQVKADDAVAEE 373 PLT A++ S ++ R +P A K G S PGA+ S + D + EE Sbjct: 354 PLTSASVASFSTSSSVVNRPTPADAAGQARKTQGYSPMVPGASSNESVSFIPDSDVIMEE 413
>POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 29.3 bits (64), Expect = 8.0 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 315 PGAEALDPSNLETASARLTGDDLHASPSRLASDRRAASVRGRPLDSRK 172 PGA +L P ++ L + P+R D RAA + RP+ + K Sbjct: 1119 PGARSLTPCTCGSSDLYLVTREADVIPARRRGDNRAALLSPRPISTLK 1166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,417,477 Number of Sequences: 219361 Number of extensions: 293769 Number of successful extensions: 1537 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1537 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)