| Clone Name | bart27g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39... | 29 | 7.8 |
|---|
>YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39 intergenic| region Length = 352 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/53 (22%), Positives = 32/53 (60%) Frame = +1 Query: 328 YCQNHLTGLVLFSWCKLMDPMTLLIASYLMLVVFTKPRLIVQKMLLQGLQIRM 486 Y ++ + +LFS+ + ++ LI S ++ ++F +PR + K ++G ++++ Sbjct: 214 YEESVILSFMLFSFIIWVILISKLILSIIIFIIFIRPRFLSSKRKVKGYELKL 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,068,153 Number of Sequences: 219361 Number of extensions: 1004386 Number of successful extensions: 3032 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3031 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)