| Clone Name | bart27e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE2_HPV1A (P03118) Regulatory protein E2 | 29 | 4.0 | 2 | CYB_XENLA (P00160) Cytochrome b | 28 | 5.2 | 3 | WBP1_MOUSE (P97764) WW domain-binding protein 1 (WBP-1) | 28 | 6.8 | 4 | WBP1_HUMAN (Q96G27) WW domain-binding protein 1 (WBP-1) | 28 | 6.8 | 5 | TXP10_PLETR (P36990) Plectoxin-10 (Plectoxin X) (PLT-X) (PLTX) | 28 | 8.9 |
|---|
>VE2_HPV1A (P03118) Regulatory protein E2| Length = 401 Score = 28.9 bits (63), Expect = 4.0 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 83 QRSTTPRGGCSQEGVSTTSDRPGA 154 +RS +PRGG +EG ST S PG+ Sbjct: 263 RRSRSPRGGGRREGESTPSRTPGS 286
>CYB_XENLA (P00160) Cytochrome b| Length = 380 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 20 HHVLPCLPRGAATLVQLHLHEQRSTTPRG 106 H +LP + GA+ L L LHE ST P G Sbjct: 183 HFLLPFIIAGASILHLLFLHETGSTNPTG 211
>WBP1_MOUSE (P97764) WW domain-binding protein 1 (WBP-1)| Length = 304 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 137 MWWILLLGNSLL*VSCCAAHGDGAAQE*QRHEEDKGGHGVLAQHG 3 +WW LL L+ SCC A A+ + ++ + +LA HG Sbjct: 91 LWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHG 135
>WBP1_HUMAN (Q96G27) WW domain-binding protein 1 (WBP-1)| Length = 269 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 137 MWWILLLGNSLL*VSCCAAHGDGAAQE*QRHEEDKGGHGVLAQHG 3 +WW LL L+ SCC A A+ + ++ + +LA HG Sbjct: 56 LWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHG 100
>TXP10_PLETR (P36990) Plectoxin-10 (Plectoxin X) (PLT-X) (PLTX)| Length = 49 Score = 27.7 bits (60), Expect = 8.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -3 Query: 99 GVVLRCSWRWSCTRVAAPRGRQGRTWCSCAAW 4 G +++C C + A +G++ + C C AW Sbjct: 4 GFLVKCDSNSECCKTAIVKGKKKQLSCLCGAW 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,223,663 Number of Sequences: 219361 Number of extensions: 406597 Number of successful extensions: 2460 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2460 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)