| Clone Name | bart26h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y4WH_RHISN (P55686) Hypothetical 15.6 kDa protein y4wH | 33 | 0.52 | 2 | ZDHC8_MOUSE (Q5Y5T5) Probable palmitoyltransferase ZDHHC8 (EC 2.... | 29 | 9.7 | 3 | ZDHC8_PANTR (Q2THX0) Probable palmitoyltransferase ZDHHC8 (EC 2.... | 29 | 9.7 | 4 | ZDHC8_HUMAN (Q9ULC8) Probable palmitoyltransferase ZDHHC8 (EC 2.... | 29 | 9.7 | 5 | CH18_DROSU (P24514) Chorion protein S18 | 29 | 9.7 | 6 | PDLI2_MACFA (Q9GKU1) PDZ and LIM domain protein 2 | 29 | 9.7 |
|---|
>Y4WH_RHISN (P55686) Hypothetical 15.6 kDa protein y4wH| Length = 145 Score = 33.1 bits (74), Expect = 0.52 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 360 TNATCAFIQDYQNCMKHGRPSLDFLQWRWRPDGGPGCELARFDAAHFFR 506 ++ T AF + + G+P + FL++R RPDGG + F+ + R Sbjct: 76 SDGTLAFADQHFTIDRDGKPVIQFLRYRIRPDGGAEFTMVVFNVPSYER 124
>ZDHC8_MOUSE (Q5Y5T5) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) Length = 762 Score = 28.9 bits (63), Expect = 9.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 517 PRTSRKKCAASKRASSQPGPPSGRHLHCRKSRLGLP 410 PRTS A + ++ PGP G H +R GLP Sbjct: 636 PRTSSSSLQADQANNNAPGPRPGSGSHRSPARQGLP 671
>ZDHC8_PANTR (Q2THX0) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) Length = 765 Score = 28.9 bits (63), Expect = 9.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 517 PRTSRKKCAASKRASSQPGPPSGRHLHCRKSRLGLP 410 PRTS A + +S+ PGP H +R GLP Sbjct: 639 PRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLP 674
>ZDHC8_HUMAN (Q9ULC8) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) (Zinc finger protein 378) Length = 765 Score = 28.9 bits (63), Expect = 9.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 517 PRTSRKKCAASKRASSQPGPPSGRHLHCRKSRLGLP 410 PRTS A + +S+ PGP H +R GLP Sbjct: 639 PRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLP 674
>CH18_DROSU (P24514) Chorion protein S18| Length = 174 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 Query: 191 PPLPRSGHALAPLPRASPIAGHPLVVR 271 PP+ R ALA L A+P AG PLV R Sbjct: 95 PPVDREAIALAKLALAAPSAGGPLVWR 121
>PDLI2_MACFA (Q9GKU1) PDZ and LIM domain protein 2| Length = 352 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +2 Query: 155 HCQDHTSFRSRCPP----LPRSGHALAPLPRASPIAGHPLVVR 271 H + H+S RS PR+G +P P +SP+AG + R Sbjct: 111 HTESHSSLRSSYSSPTSLSPRAGSPFSPPPFSSPLAGEAAISR 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,620,568 Number of Sequences: 219361 Number of extensions: 1154859 Number of successful extensions: 3886 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3886 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)