| Clone Name | bart26g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | M4K4_HUMAN (O95819) Mitogen-activated protein kinase kinase kina... | 30 | 3.6 | 2 | ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein... | 30 | 4.6 | 3 | CP1B1_HUMAN (Q16678) Cytochrome P450 1B1 (EC 1.14.14.1) (CYPIB1) | 29 | 7.9 | 4 | C89A2_ARATH (Q42602) Cytochrome P450 89A2 (EC 1.14.-.-) (CYPLXXX... | 29 | 7.9 |
|---|
>M4K4_HUMAN (O95819) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1239 Score = 30.4 bits (67), Expect = 3.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 62 PPVPKHSRSFSCSTNEASPPESQRPVCP 145 PPVP S SFS +E+ P QRP P Sbjct: 594 PPVPSRSESFSNGNSESVHPALQRPAEP 621
>ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein 38 (Zinc| finger protein expressed in neurons) (Zenon) Length = 1203 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 17 YSPCMLRVSVHASNFPPVPKHSRSFSCSTNEASPPESQRPVCP 145 YS + V VH+S F V KHS + +C N SQ P Sbjct: 701 YSGLVPSVIVHSSQFSSVIKHSNAIACLANSNHQSPSQPVASP 743
>CP1B1_HUMAN (Q16678) Cytochrome P450 1B1 (EC 1.14.14.1) (CYPIB1)| Length = 543 Score = 29.3 bits (64), Expect = 7.9 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +2 Query: 374 RLARAYGPVYSFAPLGLARPMIFVAARGPAHRALVQQGXXXXXXXXXXXXXXXVLTSGGR 553 RLAR YG V+ LG P++ + H+ALVQQG + SGGR Sbjct: 76 RLARRYGDVFQIR-LGSC-PIVVLNGERAIHQALVQQGSAFADRPAFASFR---VVSGGR 130 Query: 554 NVS 562 +++ Sbjct: 131 SMA 133
>C89A2_ARATH (Q42602) Cytochrome P450 89A2 (EC 1.14.-.-) (CYPLXXXIX) (ATH 6-1)| Length = 506 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +2 Query: 356 LEPVLRRLARAYGPVYSFAPLGLARPMIFVAARGPAHRALVQQG 487 LE LR + GP+ + +RP IFVA R H ALV G Sbjct: 54 LESYLRSVHHRLGPIVTLRIT--SRPAIFVADRSLTHEALVLNG 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,378,869 Number of Sequences: 219361 Number of extensions: 728907 Number of successful extensions: 2820 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2819 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)