| Clone Name | bart26g02 |
|---|---|
| Clone Library Name | barley_pub |
>DNAA_VIBCH (Q9KVX6) Chromosomal replication initiator protein dnaA| Length = 467 Score = 30.4 bits (67), Expect = 2.8 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 437 APRPAPPRME-DLRAENRDFWPSARAPRKPSHRWWKD 330 AP+PAP R D+ AE+ P+ A RKP H+ W D Sbjct: 85 APKPAPVRTAADVAAESSA--PAQLAQRKPIHKTWDD 119
>LEU2_AZOVI (P96195) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 470 Score = 29.3 bits (64), Expect = 6.2 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 416 RMEDLRAENRDFWPSARAPRKPSHRWW 336 R+EDLRA + AR+PR S RWW Sbjct: 353 RIEDLRAA-AEVAKGARSPRASSRRWW 378
>DNAA_VIBPA (Q87TQ7) Chromosomal replication initiator protein dnaA| Length = 468 Score = 29.3 bits (64), Expect = 6.2 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 440 TAPRPAPPRME-DLRAENRDFWPSARAPRKPSHRWWKD 330 +AP+PAP R D+ AE+ P+ RKP H+ W D Sbjct: 84 SAPKPAPTRTPADVAAESSA--PAQLQARKPVHKTWDD 119
>DNAA_VIBVY (Q7MQJ7) Chromosomal replication initiator protein dnaA| Length = 468 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 437 APRPAPPRME-DLRAENRDFWPSARAPRKPSHRWWKD 330 AP+PAP R D+ AE+ P+ RKP H+ W D Sbjct: 85 APKPAPTRTPADVAAESSA--PAQLQARKPVHKTWDD 119
>DNAA_VIBVU (Q8DDI9) Chromosomal replication initiator protein dnaA| Length = 468 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 437 APRPAPPRME-DLRAENRDFWPSARAPRKPSHRWWKD 330 AP+PAP R D+ AE+ P+ RKP H+ W D Sbjct: 85 APKPAPTRTPADVAAESSA--PAQLQARKPVHKTWDD 119
>DNAA_VIBHA (P49996) Chromosomal replication initiator protein dnaA| Length = 468 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 437 APRPAPPRME-DLRAENRDFWPSARAPRKPSHRWWKD 330 AP+PAP R D+ AE+ P+ RKP H+ W D Sbjct: 85 APKPAPTRTPADVAAESSA--PAQLQARKPVHKTWDD 119 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,121,746 Number of Sequences: 219361 Number of extensions: 297114 Number of successful extensions: 886 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)