| Clone Name | bart26c09 |
|---|---|
| Clone Library Name | barley_pub |
>CABP4_BOVIN (Q8HZJ4) Calcium-binding protein 4 (CaBP4)| Length = 279 Score = 32.0 bits (71), Expect = 1.0 Identities = 26/71 (36%), Positives = 29/71 (40%), Gaps = 9/71 (12%) Frame = -2 Query: 335 LRGLRAQPR--GSDPGCVGPRL-------RRHRERAEIGYPARRGVGPQRQLGDHRPTAA 183 LRG R P G GP R RE E P+ G+ P+RQ HRP Sbjct: 49 LRGSRKGPSSSGEQTPMQGPEAPGSSKNPSRTREGQEGPIPSASGLAPRRQSHRHRP--G 106 Query: 182 PSHSAALRCQG 150 P H AA R G Sbjct: 107 PQHDAAQRMYG 117
>PRP4B_MOUSE (Q61136) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1)| (PRP4 pre-mRNA-processing factor 4 homolog) (Pre-mRNA protein kinase) Length = 1007 Score = 32.0 bits (71), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +1 Query: 202 SPSCRWGPTPRRAGYPISARSRWRLRR 282 SP RW PT RR+ PI RSR LRR Sbjct: 431 SPINRWSPTRRRSRSPIRRRSRSPLRR 457
>PRP4B_HUMAN (Q13523) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1)| (PRP4 pre-mRNA-processing factor 4 homolog) (PRP4 kinase) Length = 1007 Score = 32.0 bits (71), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +1 Query: 202 SPSCRWGPTPRRAGYPISARSRWRLRR 282 SP RW PT RR+ PI RSR LRR Sbjct: 431 SPINRWSPTRRRSRSPIRRRSRSPLRR 457
>UL50_HCMVA (P16791) Protein UL50 (HFLF4 protein)| Length = 397 Score = 31.6 bits (70), Expect = 1.4 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 202 SPSCRWGPTPRRAGYPISARSRWRLRRGPTQPGSLP 309 SP C P+ R GY + S WR R GP++P S P Sbjct: 324 SPPC--APSLERTGYRWAPSSWWRARSGPSRPQSGP 357
>RPB1_MOUSE (P08775) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RPB1) Length = 1970 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 151 PWQRRAAEWEGAAVGRWSPSCRWGPTPRRAGYPISARS 264 PW + A A G WSPS G TP AG+ SA S Sbjct: 1519 PWNQGATP----AYGAWSPSVGSGMTPGAAGFSPSAAS 1552
>RPB1_HUMAN (P24928) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RPB1) Length = 1970 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 151 PWQRRAAEWEGAAVGRWSPSCRWGPTPRRAGYPISARS 264 PW + A A G WSPS G TP AG+ SA S Sbjct: 1519 PWNQGATP----AYGAWSPSVGSGMTPGAAGFSPSAAS 1552
>GDF1_MOUSE (P20863) Embryonic growth/differentiation factor 1 precursor| (GDF-1) Length = 357 Score = 30.0 bits (66), Expect = 4.0 Identities = 23/53 (43%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = -2 Query: 293 CVGPRLRRHRE-RAEIG----YPARRGVGPQRQLGDHRPTAAPSHSAALRCQG 150 C PRLRRH E R E+G RR R++G HR AP A CQG Sbjct: 230 CPLPRLRRHTEPRVEVGPVGTCRTRRLHVSFREVGWHRWVIAPRGFLANFCQG 282
>RECO_SYNP6 (Q5N4L9) DNA repair protein recO (Recombination protein O)| Length = 266 Score = 29.3 bits (64), Expect = 6.8 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 175 WEGAAVGRWSPSCRWGPTPRRAGYPISARSRWRLRRGPTQPGSL 306 W+ A W+P + ++A P +SRWR+R P+ G L Sbjct: 141 WQLLAWAGWAPQTHYCCLTQQAVQPRLEQSRWRVRYSPSLGGVL 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,632,755 Number of Sequences: 219361 Number of extensions: 792547 Number of successful extensions: 2578 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2574 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)