| Clone Name | bart26c07 |
|---|---|
| Clone Library Name | barley_pub |
>M3K11_HUMAN (Q16584) Mitogen-activated protein kinase kinase kinase 11 (EC| 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase) Length = 847 Score = 30.0 bits (66), Expect = 4.8 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 192 LLGSVPAVAVTPEERKAGVPAEVGNATATSRLQQ 293 L G+ P ++ PEE K VPAE G+++ T +L Q Sbjct: 609 LNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQ 642
>YIP5_YEAST (P53108) Protein YIP5 (Ypt-interacting protein 5)| Length = 310 Score = 30.0 bits (66), Expect = 4.8 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 408 YAPYFNVDTDVVVDRLISSV-YPMDGFFRKIDVNPDMYGPLWITTTLIFM 554 Y+ YF +D RL + + + D + N D+YG +WIT T++ + Sbjct: 97 YSKYFQIDLTQFKKRLSAVLTFRNDHNSESNEDNTDLYGAVWITATVVMI 146
>C84A1_ARATH (Q42600) Cytochrome P450 84A1 (EC 1.14.-.-)| (Ferulate-5-hydroxylase) (F5H) Length = 520 Score = 30.0 bits (66), Expect = 4.8 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 387 GYFNVASYAPYFN-VDTDVVVDRLISSVYPMDGFFRKI 497 G FNVA + PYF +D + RL+ + +DGF I Sbjct: 216 GAFNVADFIPYFGWIDPQGINKRLVKARNDLDGFIDDI 253
>ASHH2_ARATH (Q2LAE1) Histone-lysine N-methyltransferase, H3 lysine-4 and H3| lysine-36 specific ASHH2 (EC 2.1.1.43) (H3-K4-HMTase) (H3-K36-HMTase) (Histone H3-K36 methyltransferase 8) (ASH1-homolog protein 2) (Protein EARLY FLOWERING IN SHORT DAYS) (Prote Length = 1759 Score = 29.3 bits (64), Expect = 8.1 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = +2 Query: 317 QWRRVPAS-----GESSRWRCRNTDXLERILQC 400 +WRR+PAS ESSRW C N +R C Sbjct: 873 KWRRIPASVVGSIDESSRWICMNNSD-KRFADC 904
>GUAA_BORPE (Q7VVM4) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 530 Score = 29.3 bits (64), Expect = 8.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 8 DFPTAEFSPFPHPTLPRQKSSI 73 DF TA+++P PHP L R S I Sbjct: 484 DFMTADWAPLPHPLLARVSSRI 505
>GUAA_BORPA (Q7WAV6) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 530 Score = 29.3 bits (64), Expect = 8.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 8 DFPTAEFSPFPHPTLPRQKSSI 73 DF TA+++P PHP L R S I Sbjct: 484 DFMTADWAPLPHPLLARVSSRI 505
>GUAA_BORBR (Q7WK13) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 530 Score = 29.3 bits (64), Expect = 8.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 8 DFPTAEFSPFPHPTLPRQKSSI 73 DF TA+++P PHP L R S I Sbjct: 484 DFMTADWAPLPHPLLARVSSRI 505 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,081,103 Number of Sequences: 219361 Number of extensions: 987481 Number of successful extensions: 2798 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2798 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)