| Clone Name | bart25f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAD52_CANGA (Q6FSW2) DNA repair and recombination protein RAD52 | 31 | 2.9 | 2 | YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39... | 29 | 8.5 |
|---|
>RAD52_CANGA (Q6FSW2) DNA repair and recombination protein RAD52| Length = 505 Score = 30.8 bits (68), Expect = 2.9 Identities = 23/91 (25%), Positives = 40/91 (43%) Frame = +3 Query: 300 LPKPFDRPRAVFLVQIDGSHDSVDSFISDAGSVYKTKIDSAKNAATGLTDKDELIVIRSD 479 +P P D L + D S+++ D+ S + + K+ I S N + S Sbjct: 370 IPNPIDDSTDSRLAENDKSNENDDTETSHSTEIEKSAISSVNNGTN---------ISGST 420 Query: 480 ESSGSGVLDNELTNLATWLEGSYQKADGKLT 572 ESS + V + T+ T +E KAD +++ Sbjct: 421 ESSVTTVPSHNSTSQTTNIEAKVDKADSQVS 451
>YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39 intergenic| region Length = 352 Score = 29.3 bits (64), Expect = 8.5 Identities = 12/53 (22%), Positives = 32/53 (60%) Frame = +1 Query: 298 YCQNHLTGLVLFSWCKLMDPMTLLIASYLMLVVFTKPRLIVQKMLLQGLQIRM 456 Y ++ + +LFS+ + ++ LI S ++ ++F +PR + K ++G ++++ Sbjct: 214 YEESVILSFMLFSFIIWVILISKLILSIIIFIIFIRPRFLSSKRKVKGYELKL 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,787,028 Number of Sequences: 219361 Number of extensions: 1183500 Number of successful extensions: 3694 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3692 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)