| Clone Name | bart25f04 |
|---|---|
| Clone Library Name | barley_pub |
>TILS_STAAR (Q6GJG2) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 30.0 bits (66), Expect = 4.4 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -1 Query: 166 SATGEQSR------EHHNYETHVRQLEGSHGNRRSSSLHFLPMICKLEWLKQL 26 SA+ E++R E H+ + H+++L+ SH R++S+ I + EW ++ Sbjct: 53 SASIEEARFLEAYCERHHIDLHIKKLDLSHSLNRNNSIQNEARIKRYEWFDEM 105
>TILS_STAAW (Q8NXZ4) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 29.3 bits (64), Expect = 7.6 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -1 Query: 166 SATGEQSR------EHHNYETHVRQLEGSHGNRRSSSLHFLPMICKLEWLKQL 26 SA+ E++R E H+ + H+++L+ SH R++S+ I + EW ++ Sbjct: 53 SASIEEARFLEVYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEM 105
>TILS_STAAS (Q6GBX9) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 29.3 bits (64), Expect = 7.6 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -1 Query: 166 SATGEQSR------EHHNYETHVRQLEGSHGNRRSSSLHFLPMICKLEWLKQL 26 SA+ E++R E H+ + H+++L+ SH R++S+ I + EW ++ Sbjct: 53 SASIEEARFLEVYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEM 105
>TILS_STAAN (Q7A7A6) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 29.3 bits (64), Expect = 7.6 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -1 Query: 166 SATGEQSR------EHHNYETHVRQLEGSHGNRRSSSLHFLPMICKLEWLKQL 26 SA+ E++R E H+ + H+++L+ SH R++S+ I + EW ++ Sbjct: 53 SASIEEARFLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEM 105
>TILS_STAAM (Q99W94) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 29.3 bits (64), Expect = 7.6 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -1 Query: 166 SATGEQSR------EHHNYETHVRQLEGSHGNRRSSSLHFLPMICKLEWLKQL 26 SA+ E++R E H+ + H+++L+ SH R++S+ I + EW ++ Sbjct: 53 SASIEEARFLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEM 105
>TILS_STAAC (Q5HIG6) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 431 Score = 29.3 bits (64), Expect = 7.6 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -1 Query: 166 SATGEQSR------EHHNYETHVRQLEGSHGNRRSSSLHFLPMICKLEWLKQL 26 SA+ E++R E H+ + H+++L+ SH R++S+ I + EW ++ Sbjct: 53 SASIEEARFLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEM 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,716,532 Number of Sequences: 219361 Number of extensions: 892655 Number of successful extensions: 2758 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2756 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)