| Clone Name | bart25b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YR224_MIMIV (Q5UQB7) Putative BTB/POZ domain-containing protein ... | 29 | 7.9 |
|---|
>YR224_MIMIV (Q5UQB7) Putative BTB/POZ domain-containing protein R224| Length = 540 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/76 (22%), Positives = 31/76 (40%) Frame = +2 Query: 8 TLLQFIHRPFPAGHLSALYHQYCGCYCYIYINQTKRIHHHLPSFLPWGVYIDYIDRRSEK 187 TL+ H F + H +YH C Y Y +N T + + I + Sbjct: 198 TLINNGHFEFSSIHNKIIYHHVCDIYVYDLLNYTT------------NKFTNPISHTIKS 245 Query: 188 MAMPPAEKVIVVDANP 235 + + P ++ I+ D++P Sbjct: 246 IVLTPDQEYIIYDSSP 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,912,558 Number of Sequences: 219361 Number of extensions: 1030729 Number of successful extensions: 3009 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3009 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)