| Clone Name | bart24h05 |
|---|---|
| Clone Library Name | barley_pub |
>NLTP1_PHAAU (P83434) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 91 Score = 30.4 bits (67), Expect = 3.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 298 ADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTP 408 AD R +CS + ++ I+P A LP KCG+ P Sbjct: 42 ADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIP 78
>UBE4B_HUMAN (O95155) Ubiquitin conjugation factor E4 B (Ubiquitin-fusion| degradation protein 2) (Homozygously deleted in neuroblastoma 1) Length = 1302 Score = 29.6 bits (65), Expect = 5.3 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 4 PPQQPFHPSSTDDRPSSLRLARQ-QASSARSVW 99 PP P PS+T RPSSLR++ AS S W Sbjct: 377 PPLPPASPSATSRRPSSLRISPSLGASGGASNW 409
>PP2A2_ARATH (Q07099) Serine/threonine-protein phosphatase PP2A-2 catalytic| subunit (EC 3.1.3.16) Length = 306 Score = 29.3 bits (64), Expect = 6.9 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +1 Query: 280 CATLGKADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTPPDC*IQFHGM 438 C LG+AD++ LC + + YN+ P KC +T D QF+ + Sbjct: 17 CKPLGEADVKILCDQAKAILVEEYNVQ-------PVKCPVTVCGDIHGQFYDL 62
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Frame = +1 Query: 268 SEACC--------ATLGKADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTP 408 S ACC A AD R C+ + S+ ++ A +P+KCG+T P Sbjct: 51 SAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVTIP 105
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 298 ADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTP 408 AD R C+ S+ ++P A LP KCG+ P Sbjct: 42 ADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVP 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,003,723 Number of Sequences: 219361 Number of extensions: 875126 Number of successful extensions: 2302 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2302 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)