| Clone Name | bart24b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CY24A_MOUSE (Q61462) Cytochrome b-245 light chain (p22 phagocyte... | 29 | 10.0 | 2 | MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemota... | 29 | 10.0 | 3 | DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7) | 29 | 10.0 |
|---|
>CY24A_MOUSE (Q61462) Cytochrome b-245 light chain (p22 phagocyte B-cytochrome)| (Neutrophil cytochrome b 22 kDa polypeptide) (p22-phox) (p22phox) (Cytochrome b(558) alpha chain) (Cytochrome b558 alpha subunit) (Superoxide-generating NADPH oxidase light ch Length = 191 Score = 28.9 bits (63), Expect = 10.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 447 DPDARPDTDAEQKPFHGEEEAAKA 518 +P RP + +KP GEEEAA A Sbjct: 153 NPPPRPPAEVRKKPSEGEEEAASA 176
>MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemotaxis protein)| Length = 657 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -3 Query: 190 TSAAASD*SSWVRRTALGGPWSSEVVSRTR 101 T+AA + ++ VRRTA G +S+VVS TR Sbjct: 386 TAAALDELTATVRRTAAGARQASDVVSTTR 415
>DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1073 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 306 GISHHRGAFSGPGEVRDHPAFDVVPTELAR 395 G H G SG + D P DVVPTE AR Sbjct: 525 GQPRHLGIHSGGMVICDRPIADVVPTEWAR 554 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,528,170 Number of Sequences: 219361 Number of extensions: 806906 Number of successful extensions: 2850 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2848 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)