| Clone Name | bart22h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FD2_DROME (Q02360) Fork head domain protein FD2 | 30 | 4.5 | 2 | Y4103_VIBPA (Q87JZ5) UPF0189 protein VPA0103 | 29 | 7.8 | 3 | M3K1_MOUSE (P53349) Mitogen-activated protein kinase kinase kina... | 29 | 7.8 |
|---|
>FD2_DROME (Q02360) Fork head domain protein FD2| Length = 365 Score = 30.0 bits (66), Expect = 4.5 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 380 RPRLSKNRRSPRSLGGAGAEGTLRGAGAPA 469 R ++S N +P ++GGAG EG + G+ +PA Sbjct: 30 RTQVSPNPLAPSAVGGAGMEGLMCGSFSPA 59
>Y4103_VIBPA (Q87JZ5) UPF0189 protein VPA0103| Length = 170 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 398 NRRSPRSLGGAGAEGTLRGAGAPASIS 478 N +PR LGG G +G + A PA I+ Sbjct: 21 NAANPRMLGGGGVDGAIHRAAGPALIN 47
>M3K1_MOUSE (P53349) Mitogen-activated protein kinase kinase kinase 1 (EC| 2.7.11.25) (MAPK/ERK kinase kinase 1) (MEK kinase 1) (MEKK 1) Length = 1493 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 407 SPRSLGGAGAEGTLRGAGAPAS 472 SP + GG G G L+G+GAPA+ Sbjct: 21 SPEAGGGGGGGGALQGSGAPAA 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,789,284 Number of Sequences: 219361 Number of extensions: 712186 Number of successful extensions: 3516 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3508 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)