| Clone Name | bart22f10 |
|---|---|
| Clone Library Name | barley_pub |
>AGAR_STRCO (P07883) Extracellular agarase precursor (EC 3.2.1.81)| Length = 309 Score = 32.7 bits (73), Expect = 0.71 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 328 DQHADGTLGPLHFLHPARRAFLSD-----KGRGWCLDCVHCGHPAALLPTSLP 471 DQH DG GP + L+ AR ++++D +GR V+CG+ + P P Sbjct: 75 DQHKDGWSGPANSLYSARHSWVADGNLIVEGRRAPDGRVYCGYVTSRTPVEYP 127
>Y867_HAEIN (Q57484) Hypothetical protein HI0867| Length = 404 Score = 31.6 bits (70), Expect = 1.6 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 13/106 (12%) Frame = +2 Query: 275 LAFIAAVYFLVLDRTNWKTNMLTGLLVPYIFFTLPG-----------VLFSLIRGEVGAW 421 +AFI +V+ L +++ LVPY+F L L SL+ + + Sbjct: 245 IAFILSVFILAINKA----------LVPYLFEKLKQGSVKLKDLHRWSLLSLLIVPIPSL 294 Query: 422 IAFIVVI--LRLFFPRHFPGIIFLSILFLIAVPSKLSLCIAYLILI 553 + IV L F +HF G+ + I+FL++ SL I YL L+ Sbjct: 295 VTLIVPEQWLLFFLGKHFIGVKYYIIVFLLST----SLTIPYLFLV 336
>LAX2_ARATH (Q9S836) Auxin transporter-like protein 2 (AUX1-like protein 2)| Length = 483 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 347 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 445 L +PY F L G+LF L G +G+W A+++ IL Sbjct: 59 LTLPYSFSQLGMLSGILFQLFYGILGSWTAYLISIL 94
>YFEA_ECOLI (P23842) Hypothetical protein yfeA| Length = 729 Score = 30.8 bits (68), Expect = 2.7 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 7/103 (6%) Frame = +2 Query: 266 LKWLAFIAAVYFLVLDRTNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVG------AWIA 427 L WLA ++ + L+ T ++ + + G LVP F ++F+L G++ W Sbjct: 217 LSWLAALSVLLLLLC--TPYENDFIAGYLVPVFF-----IIFTLGVGKLRYPFLNLTWAV 269 Query: 428 FIVVILRLFFPRHFPGI-IFLSILFLIAVPSKLSLCIAYLILI 553 + +L + G+ S+ F++AV S+C+ Y++ I Sbjct: 270 STLCLLN-YNQNFLQGVETEYSLAFILAVLISFSVCLLYMVRI 311
>LAX5_MEDTR (Q8L883) Auxin transporter-like protein 5 (AUX1-like protein 5)| (MtLAX5) Length = 490 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 347 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 445 L +PY F L G+LF L G +G+W A+++ IL Sbjct: 61 LTLPYSFSQLGMLSGILFQLFYGILGSWTAYLISIL 96
>LAX3_MEDTR (Q9FEL6) Auxin transporter-like protein 3 (AUX1-like protein 3)| (MtLAX3) Length = 465 Score = 30.4 bits (67), Expect = 3.5 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 347 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 445 L +PY F L G+LF + G +G+W A+I+ +L Sbjct: 58 LTLPYSFSQLGMLSGILFQIFYGLMGSWTAYIISVL 93
>Y585_METJA (Q58005) Hypothetical protein MJ0585| Length = 205 Score = 30.4 bits (67), Expect = 3.5 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = +2 Query: 266 LKWLAFIAAVYFLVLDRTNW---KTNMLT-----GLLVPYIFFTLPGVLFSLIRGEVGAW 421 +KW I+ + ++ T W K L GL+VP++ F +P LF+++ + + Sbjct: 104 MKWFIAISILILGIILATLWILRKDKFLLFLAIFGLIVPFLQFKIPNWLFNILALPLFVY 163 Query: 422 IAFIV 436 I FIV Sbjct: 164 IKFIV 168
>LAX3_ARATH (Q9CA25) Auxin transporter-like protein 3 (AUX1-like protein 3)| Length = 470 Score = 30.4 bits (67), Expect = 3.5 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 347 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 445 L +PY F L G+LF L G +G+W A+++ +L Sbjct: 63 LTLPYSFSQLGMMSGILFQLFYGLMGSWTAYLISVL 98
>CRCB_NEIMB (Q9JZG6) Protein crcB homolog| Length = 119 Score = 30.4 bits (67), Expect = 3.5 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 191 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYFLVLDRTNWKTNMLTGLL 352 LG AR L N A+ F W+ AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWKLLLITGFL 68
>COX1_RHILE (Q08855) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Cytochrome aa3 subunit 1) Length = 538 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 359 YIFFTLPGVLFSLIRGEVGAWIAFIVVILRLFFPRHFPGI 478 Y F + G +++ E W+ FI V L +FFP HF GI Sbjct: 419 YWFPKMSGYMYNETLAEAHFWLIFIGVNL-IFFPEHFLGI 457
>CRCB_NEIMA (Q9JUL1) Protein crcB homolog| Length = 119 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 191 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYFLVLDRTNWKTNMLTGLL 352 LG AR L N A+ F W AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASLSPATGNLFANWTGAFLIGIFAETVNHPQWKLLLITGFL 68
>INVO_TARBA (P24711) Involucrin| Length = 387 Score = 29.3 bits (64), Expect = 7.9 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 12/67 (17%) Frame = -1 Query: 457 EEEPQDDHNERNPGTNLS-PYQREKHAGQ-----------GEENVRDQESRQHVGLPVCP 314 ++EPQ+ E +PG P ++E H G+ G++ + QE H+G Sbjct: 86 QQEPQEQ--EVHPGKQQQKPQEQEAHLGKKQEPQGQEVHLGKQQQKTQEQEVHLGKQQQE 143 Query: 313 VQYQEVH 293 +Q QEVH Sbjct: 144 LQEQEVH 150
>ACTP_PHOLL (Q7NA72) Cation/acetate symporter actP (Acetate transporter actP)| (Acetate permease) Length = 549 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +2 Query: 272 WLAFIAAVYFLVLDRTNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAWI 424 WL I AV ++L T W + + G P + P LFS+I +G+W+ Sbjct: 466 WLGLITAVVLMILGPTIWVS--ILGHEKPIYPYEYP-ALFSMIIAFIGSWL 513
>GTR14_HUMAN (Q8TDB8) Solute carrier family 2, facilitated glucose transporter| member 14 (Glucose transporter type 14) Length = 520 Score = 29.3 bits (64), Expect = 7.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 317 TNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAWIAF 430 +NW +N L GLL P + L +F + G + ++AF Sbjct: 432 SNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAF 469 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,652,209 Number of Sequences: 219361 Number of extensions: 1024082 Number of successful extensions: 3558 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3554 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)