| Clone Name | bart22f02 |
|---|---|
| Clone Library Name | barley_pub |
>Y4WH_RHISN (P55686) Hypothetical 15.6 kDa protein y4wH| Length = 145 Score = 32.0 bits (71), Expect = 0.37 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 262 TNATCAFIQDYQNCMKHGRPSLDFLQWRWRPDGG 363 ++ T AF + + G+P + FL++R RPDGG Sbjct: 76 SDGTLAFADQHFTIDRDGKPVIQFLRYRIRPDGG 109
>CH18_DROSU (P24514) Chorion protein S18| Length = 174 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 93 PPLPRSGHALAPLPRASPIAGHPLVVR 173 PP+ R ALA L A+P AG PLV R Sbjct: 95 PPVDREAIALAKLALAAPSAGGPLVWR 121
>PDLI2_MACFA (Q9GKU1) PDZ and LIM domain protein 2| Length = 352 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +3 Query: 57 HCQDHTSFRSRCPP----LPRSGHALAPLPRASPIAGHPLVVR 173 H + H+S RS PR+G +P P +SP+AG + R Sbjct: 111 HTESHSSLRSSYSSPTSLSPRAGSPFSPPPFSSPLAGEAAISR 153
>GCSP2_PSEPK (Q88CI9) Glycine dehydrogenase [decarboxylating] 2 (EC 1.4.4.2)| (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 957 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 254 GSAPAGSRTH-SPSVVSHAVAPMPWVLPPDDEGVS 153 G P G R H P V SH V P+P L P++ VS Sbjct: 719 GMGPIGIRAHLKPFVASHPVVPVPG-LDPNNSAVS 752
>YR848_MIMIV (Q5UP11) Putative ankyrin repeat protein R848| Length = 262 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 232 RDPAGALPHYTNATCAFIQDYQNCMKHGRP 321 ++ L Y N C I Y NC+KH P Sbjct: 233 KNKTAKLVEYMNIFCHIINKYDNCVKHLMP 262
>TULP4_HUMAN (Q9NRJ4) Tubby-like protein 4 (Tubby superfamily protein)| Length = 1544 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 87 RCPPLPRSGHALAPLPRA---SPIAGHPLVVRRQYP 185 + P LPR+ L+ PR P G P + RR++P Sbjct: 551 KSPKLPRAAQELSRSPRLPLRKPSVGSPSLTRREFP 586
>HEMH_CHICK (O42479) Ferrochelatase, mitochondrial precursor (EC 4.99.1.1)| (Protoheme ferro-lyase) (Heme synthetase) Length = 402 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 200 VAPMPWVLPPDDEGVSG 150 V PMPW++P DE + G Sbjct: 284 VGPMPWLVPQTDETIKG 300
>ANFC_ACITR (Q76KW6) C-type natriuretic peptide precursor| Length = 150 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 380 ASSQPGPPSGRHLHCRKSRLGL 315 A SQ PPS R LH R RLGL Sbjct: 71 ALSQRAPPSIRALHPRSGRLGL 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,736,155 Number of Sequences: 219361 Number of extensions: 875377 Number of successful extensions: 3024 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3024 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)