| Clone Name | bart22b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYV_CLOAB (Q97GG8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 32 | 1.5 | 2 | ALO_YEAST (P54783) D-arabinono-1,4-lactone oxidase (EC 1.1.3.37)... | 30 | 5.9 | 3 | SYV_CLOTE (Q891R5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 29 | 10.0 |
|---|
>SYV_CLOAB (Q97GG8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 881 Score = 31.6 bits (70), Expect = 1.5 Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = +3 Query: 177 KELDQLRKEQDDVASEINKIHKKIISSPEMVDKSVDAMMAGLR 305 KE+++L KE+D + +EI ++ KK +S+ VDK+ ++++ R Sbjct: 819 KEIERLSKEKDKLKAEIQRVDKK-LSNKGFVDKAPESVVEAER 860
>ALO_YEAST (P54783) D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) (ALO)| (L-galactono-gamma-lactone oxidase) Length = 526 Score = 29.6 bits (65), Expect = 5.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 107 RGRHTRLGSDGRAQSTWGLTLGAFFY 30 RG T +G A+S WG LG FFY Sbjct: 237 RGNKTTDAQNGPAKSWWGTKLGRFFY 262
>SYV_CLOTE (Q891R5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 880 Score = 28.9 bits (63), Expect = 10.0 Identities = 13/39 (33%), Positives = 27/39 (69%) Frame = +3 Query: 177 KELDQLRKEQDDVASEINKIHKKIISSPEMVDKSVDAMM 293 KE+++L KE++ + EI ++ KK +S+ V K+ +A++ Sbjct: 818 KEMERLNKEREKLEKEIERVDKK-LSNENFVKKAPEAVV 855 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,757,568 Number of Sequences: 219361 Number of extensions: 965674 Number of successful extensions: 2647 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2647 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)