| Clone Name | bart20d02 |
|---|---|
| Clone Library Name | barley_pub |
>LDLR_HUMAN (P01130) Low-density lipoprotein receptor precursor (LDL receptor)| Length = 860 Score = 32.0 bits (71), Expect = 1.3 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +1 Query: 277 GDSLNRNENGVECQRDVCVCYKLPCDGSPE 366 GD RNE +CQ C+ YK CDGS E Sbjct: 24 GDRCERNE--FQCQDGKCISYKWVCDGSAE 51
>LDLR_RABIT (P20063) Low-density lipoprotein receptor (LDL receptor) (Fragment)| Length = 837 Score = 31.6 bits (70), Expect = 1.8 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 277 GDSLNRNENGVECQRDVCVCYKLPCDGSPE 366 GD RNE +C+ C+ YK CDGS E Sbjct: 11 GDKCGRNE--FQCRNGKCISYKWVCDGSSE 38
>XYLS3_PSEPU (Q05335) XylDLEGF operon transcriptional activator 3| Length = 331 Score = 30.8 bits (68), Expect = 3.0 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +1 Query: 334 CYKLPCDGSPELNVIYRRDDSLELNDIEASNRFNIDTTGLVCCWPSEEVLAFYCI 498 C +LP G PE ++ + SL+L I + + GL C+ + +L +C+ Sbjct: 33 CIRLPKSGCPEASLNHSTFGSLDLCRISYGGSVRVTSPGLETCYHLQVLLKGHCL 87
>CASC5_HUMAN (Q8NG31) Protein CASC5 (Cancer susceptibility candidate gene 5| protein) (ALL1-fused gene from chromosome 15q14) (AF15q14) (D40/AF15q14 protein) Length = 2342 Score = 30.8 bits (68), Expect = 3.0 Identities = 13/58 (22%), Positives = 27/58 (46%) Frame = +1 Query: 133 SASPHASEGTSKDPQEKGDTNKISRKTSRGFNLIKCHTVPISQLNKSQGDSLNRNENG 306 ++S H + K+ + + ++ R+ G N +CHT I L + ++ +R G Sbjct: 277 ASSTHQMHVSLKEDENNSNITRLFREKDDGMNFTQCHTANIQTLIPTSSETNSRESKG 334
>ADA18_MOUSE (Q9R157) ADAM 18 precursor (A disintegrin and metalloproteinase| domain 18) (Transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III) (tMDC III) (ADAM 27) Length = 719 Score = 30.0 bits (66), Expect = 5.1 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +2 Query: 482 LPSTVSTIQICSGLKGCLNLELVT 553 +P+++ T+ ICSGL+G L LE V+ Sbjct: 100 VPNSIVTLSICSGLRGFLQLENVS 123
>PRKDC_CHICK (Q8QGX4) DNA-dependent protein kinase catalytic subunit (EC| 2.7.11.1) (DNA-PK catalytic subunit) (DNA-PKcs) Length = 4134 Score = 29.6 bits (65), Expect = 6.7 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 151 SEGTSKDPQEKGDTNKISRKTSRGFNLIKCHTVPISQLNKSQGDSLNRN 297 + T+ +PQ + K+SR +GFN + I +L K++ SL+ N Sbjct: 798 NSATTVEPQNNWEVRKLSRAAQKGFN-----KIVIQRLRKAKTSSLDDN 841
>LDLR_MOUSE (P35951) Low-density lipoprotein receptor precursor (LDL receptor)| Length = 864 Score = 29.3 bits (64), Expect = 8.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 280 DSLNRNENGVECQRDVCVCYKLPCDGSPE 366 DS +RNE +C+ C+ K CDGSPE Sbjct: 25 DSGSRNE--FQCRDGKCIASKWVCDGSPE 51
>ADA32_MOUSE (Q8K410) ADAM 32 precursor (A disintegrin and metalloprotease| domain 32) Length = 750 Score = 29.3 bits (64), Expect = 8.7 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 455 YVVGRLKRSLPSTVSTIQICSGLKGCLNLELVT 553 Y G +K P++V+T+ CSGL+G L E V+ Sbjct: 93 YYQGHIK-GYPNSVATLSTCSGLRGFLQFENVS 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,354,685 Number of Sequences: 219361 Number of extensions: 1230762 Number of successful extensions: 2968 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2948 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)