| Clone Name | bart19h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRCA_ANAVT (P23916) Calcium-dependent protease precursor (EC 3.4... | 31 | 2.3 |
|---|
>PRCA_ANAVT (P23916) Calcium-dependent protease precursor (EC 3.4.21.-)| (Trypsin) Length = 662 Score = 31.2 bits (69), Expect = 2.3 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 484 PSEEETEKWFNQYQVKTSASXAGLSVLHFKQELHD 588 P + NQ+++ T S AG+ VLH K+ HD Sbjct: 43 PVSPQARNILNQFELSTRFSQAGVEVLHVKEPSHD 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.132 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,576,193 Number of Sequences: 219361 Number of extensions: 470348 Number of successful extensions: 1132 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1132 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)