| Clone Name | bart19a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IPMK_HUMAN (Q8NFU5) Inositol polyphosphate multikinase (EC 2.7.1... | 32 | 1.4 | 2 | IPMK_RAT (Q99NI4) Inositol polyphosphate multikinase (EC 2.7.1.1... | 32 | 1.4 | 3 | IPMK_MOUSE (Q7TT16) Inositol polyphosphate multikinase (EC 2.7.1... | 32 | 1.4 |
|---|
>IPMK_HUMAN (Q8NFU5) Inositol polyphosphate multikinase (EC 2.7.1.151)| (Inositol 1,3,4,6-tetrakisphosphate 5-kinase) Length = 416 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 272 GEVAVPDEVDGDAAGEERTLVVLHGDGRVLHQRREPPRG 156 G V + +V G G+++ ++ H DG VL Q + PPRG Sbjct: 45 GCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRG 83
>IPMK_RAT (Q99NI4) Inositol polyphosphate multikinase (EC 2.7.1.151)| (Inositol 1,3,4,6-tetrakisphosphate 5-kinase) Length = 396 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 272 GEVAVPDEVDGDAAGEERTLVVLHGDGRVLHQRREPPRG 156 G V + +V G G+++ ++ H DG VL Q + PPRG Sbjct: 28 GCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRG 66
>IPMK_MOUSE (Q7TT16) Inositol polyphosphate multikinase (EC 2.7.1.151)| (Inositol 1,3,4,6-tetrakisphosphate 5-kinase) Length = 396 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 272 GEVAVPDEVDGDAAGEERTLVVLHGDGRVLHQRREPPRG 156 G V + +V G G+++ ++ H DG VL Q + PPRG Sbjct: 28 GCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRG 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,114,971 Number of Sequences: 219361 Number of extensions: 466013 Number of successful extensions: 1741 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1741 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)