| Clone Name | bart18b04 |
|---|---|
| Clone Library Name | barley_pub |
>RO52_MOUSE (Q62191) 52 kDa Ro protein (Sjoegren syndrome type A antigen)| (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif protein 21) Length = 470 Score = 42.0 bits (97), Expect = 0.001 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C +CL P+++P++ GH FCKECI E Sbjct: 20 CSICLDPMVEPMSIECGHCFCKECIFE 46
>LNX2_MOUSE (Q91XL2) Ligand of Numb-protein X 2 (Numb-binding protein 2)| Length = 687 Score = 41.6 bits (96), Expect = 0.002 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKKD 396 C +CL+PL+ PL P GHTFC +C+ L Q+KD Sbjct: 51 CHICLQPLLQPLDTPCGHTFCHKCLRNFL--QEKD 83
>LNX2_HUMAN (Q8N448) Ligand of Numb-protein X 2 (Numb-binding protein 2) (PDZ| domain-containing RING finger protein 1) Length = 690 Score = 41.2 bits (95), Expect = 0.002 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKKD 396 C +CL+PL+ PL P GHTFC +C+ L Q+KD Sbjct: 50 CHICLQPLLQPLDTPCGHTFCYKCLRNFL--QEKD 82
>PEX10_HUMAN (O60683) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (RING finger protein 69) Length = 326 Score = 39.3 bits (90), Expect = 0.009 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 7/67 (10%) Frame = +1 Query: 235 GYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECI-------LECLLAQKK 393 G +R L + ++ C LCL+ P A P GH FC ECI EC L ++K Sbjct: 254 GLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREK 313 Query: 394 DIKRKLI 414 +KLI Sbjct: 314 FPPQKLI 320
>PEX10_MACFA (Q8HXW8) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 326 Score = 38.9 bits (89), Expect = 0.012 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 7/67 (10%) Frame = +1 Query: 235 GYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECI-------LECLLAQKK 393 G +R L + ++ C LCL+ P A P GH FC ECI EC L ++K Sbjct: 254 GLSHRRGSLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREK 313 Query: 394 DIKRKLI 414 +KLI Sbjct: 314 FPPQKLI 320
>PZRN3_MOUSE (Q69ZS0) PDZ domain-containing RING finger protein 3 (Semaphorin| cytoplasmic domain-associated protein 3) (SEMACAP3 protein) Length = 1063 Score = 38.5 bits (88), Expect = 0.015 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +1 Query: 241 GTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECIL 369 G + +R D + P C LC K L DPL P GH FC C+L Sbjct: 2 GFELDRFDGD-VDPDLKCALCHKVLEDPLTTPCGHVFCAGCVL 43
>PZRN3_HUMAN (Q9UPQ7) PDZ domain-containing RING finger protein 3 (Ligand of| Numb-protein X 3) (Semaphorin cytoplasmic domain-associated protein 3) (SEMACAP3 protein) Length = 1066 Score = 38.5 bits (88), Expect = 0.015 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +1 Query: 241 GTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECIL 369 G + +R D + P C LC K L DPL P GH FC C+L Sbjct: 2 GFELDRFDGD-VDPDLKCALCHKVLEDPLTTPCGHVFCAGCVL 43
>PZRN3_RAT (P68907) PDZ domain-containing RING finger protein 3 (Semaphorin| cytoplasmic domain-associated protein 3) (SEMACAP3 protein) Length = 1062 Score = 37.7 bits (86), Expect = 0.026 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 274 IKPFDACCLCLKPLIDPLACPKGHTFCKECIL 369 + P C LC K L DPL P GH FC C+L Sbjct: 12 VDPDLKCALCHKVLEDPLTTPCGHVFCAGCVL 43
>LNX1_MOUSE (O70263) Ubiquitin ligase LNX (EC 6.3.2.-) (Numb-binding protein 1)| (Ligand of Numb-binding protein 1) (Ligand of Numb-protein X 1) Length = 728 Score = 37.7 bits (86), Expect = 0.026 Identities = 24/70 (34%), Positives = 32/70 (45%) Frame = +1 Query: 172 QRHSKNNNDLAFFTYEEKRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTF 351 Q HS N F+TY E + D I C +CL+ L+DPL P GHT+ Sbjct: 23 QNHSPEENH--FYTYTED-----------VDDDLI-----CHICLQALLDPLDTPCGHTY 64 Query: 352 CKECILECLL 381 C C+ L+ Sbjct: 65 CTLCLTNFLV 74
>TRI15_MACMU (Q5TM55) Tripartite motif protein 15| Length = 465 Score = 37.7 bits (86), Expect = 0.026 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECI 366 AC LC+ PL D + P GHTFC+ C+ Sbjct: 15 ACTLCVGPLEDAVTAPCGHTFCRLCL 40
>RO52_HUMAN (P19474) 52 kDa Ro protein (Sjoegren syndrome type A antigen)| (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif protein 21) (RING finger protein 81) Length = 475 Score = 37.4 bits (85), Expect = 0.034 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL P ++P++ GH+FC+ECI Sbjct: 16 CPICLDPFVEPVSIECGHSFCQECI 40
>LNX1_HUMAN (Q8TBB1) Ubiquitin ligase LNX (EC 6.3.2.-) (Numb-binding protein 1)| (Ligand of Numb-protein X 1) Length = 728 Score = 37.4 bits (85), Expect = 0.034 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLL 381 C +CL+ L+DPL P GHT+C C+ L+ Sbjct: 41 CHICLQALLDPLDTPCGHTYCTLCLTNFLV 70
>TRI47_MOUSE (Q8C0E3) Tripartite motif protein 47| Length = 641 Score = 37.0 bits (84), Expect = 0.045 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPKGHTFCKECI 366 D PF +C +CL+PL +P+ P GH FC C+ Sbjct: 2 DGSGPF-SCPICLEPLREPVTLPCGHNFCLACL 33
>TRI47_HUMAN (Q96LD4) Tripartite motif protein 47 (Gene overexpressed in| astrocytoma protein) (RING finger protein 100) Length = 638 Score = 37.0 bits (84), Expect = 0.045 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPKGHTFCKECI 366 D PF +C +CL+PL +P+ P GH FC C+ Sbjct: 2 DGSGPF-SCPICLEPLREPVTLPCGHNFCLACL 33
>TRI11_MOUSE (Q99PQ2) Tripartite motif protein 11 (EC 6.3.2.-)| Length = 467 Score = 36.6 bits (83), Expect = 0.059 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILEC 375 C +CL DP+ GH FC+ECI C Sbjct: 16 CAICLDYFTDPVMTDCGHNFCRECIRRC 43
>ZN313_RAT (Q6J2U6) Zinc finger protein 313| Length = 229 Score = 36.6 bits (83), Expect = 0.059 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 C +CL+ P+ P GH FC C+ ECL +K Sbjct: 30 CPVCLEVFEKPVQVPCGHVFCSACLQECLKPKK 62
>ZN313_MOUSE (Q9ET26) Zinc finger protein 313| Length = 229 Score = 36.6 bits (83), Expect = 0.059 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 C +CL+ P+ P GH FC C+ ECL +K Sbjct: 30 CPVCLEVFEKPVQVPCGHVFCSACLQECLKPKK 62
>TRI25_HUMAN (Q14258) Tripartite motif protein 25 (Zinc finger protein 147)| (Estrogen-responsive finger protein) (Efp) (RING finger protein 147) Length = 630 Score = 36.6 bits (83), Expect = 0.059 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECLLAQ 387 +C +CL+P +P+ P GH FC C+ E Q Sbjct: 12 SCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQ 44
>TRI11_HUMAN (Q96F44) Tripartite motif protein 11 (EC 6.3.2.-) (RING finger| protein 92) (BIA1 protein) Length = 468 Score = 36.6 bits (83), Expect = 0.059 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILEC 375 C +CL DP+ GH FC+ECI C Sbjct: 16 CAICLDYFTDPVMTDCGHNFCRECIRRC 43
>TRI15_PANTR (Q7YR33) Tripartite motif protein 15 (Zinc finger protein B7)| Length = 465 Score = 36.6 bits (83), Expect = 0.059 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECI 366 AC LC PL D + P GHTFC+ C+ Sbjct: 15 ACTLCAGPLEDAVTVPCGHTFCRLCL 40
>TRI15_HUMAN (Q9C019) Tripartite motif protein 15 (Zinc finger protein B7) (RING| finger protein 93) (Zinc finger protein 178) Length = 465 Score = 36.6 bits (83), Expect = 0.059 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECI 366 AC LC PL D + P GHTFC+ C+ Sbjct: 15 ACTLCAGPLEDAVTIPCGHTFCRLCL 40
>ZN313_PIG (Q6J1I8) Zinc finger protein 313| Length = 228 Score = 36.2 bits (82), Expect = 0.077 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 C +CL+ P+ P GH FC C+ ECL +K Sbjct: 29 CPVCLEVYEKPVQVPCGHVFCSACLQECLKPKK 61
>ZN313_PANTR (Q6J212) Zinc finger protein 313| Length = 228 Score = 36.2 bits (82), Expect = 0.077 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 C +CL+ P+ P GH FC C+ ECL +K Sbjct: 29 CPVCLEVYEKPVQVPCGHVFCSACLQECLKPKK 61
>ZN313_HUMAN (Q9Y508) Zinc finger protein 313 (RING finger protein 114)| Length = 228 Score = 36.2 bits (82), Expect = 0.077 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 C +CL+ P+ P GH FC C+ ECL +K Sbjct: 29 CPVCLEVYEKPVQVPCGHVFCSACLQECLKPKK 61
>ZN313_BOVIN (Q4U5R4) Zinc finger protein 313| Length = 230 Score = 36.2 bits (82), Expect = 0.077 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 C +CL+ P+ P GH FC C+ ECL +K Sbjct: 31 CPVCLEVYEKPVQVPCGHVFCSACLQECLKPKK 63
>SMRA3_RABIT (Q95216) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (RUSH-1) Length = 1005 Score = 36.2 bits (82), Expect = 0.077 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECILECLLAQKKDIKRKLIAHD 423 + C +CL L P+ H FCK CI +C+ ++ K L +D Sbjct: 755 EECAICLDSLTVPVITHCAHVFCKPCICQCIQNEQPHAKCPLCRND 800
>CWC24_CANAL (Q5ACW2) Pre-mRNA-splicing factor CWC24| Length = 216 Score = 36.2 bits (82), Expect = 0.077 Identities = 22/57 (38%), Positives = 28/57 (49%) Frame = +1 Query: 223 KRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 K+ G Q+E K+ I PF C LC P+ GH FCK C L+ A+KK Sbjct: 135 KKDWEIGGQKEVKEKEDI-PFK-CVLCKSDYKSPIKTECGHIFCKACFLDRYKAKKK 189
>PEX10_PICAN (Q00940) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (Peroxisome assembly protein PER8) Length = 295 Score = 35.8 bits (81), Expect = 0.10 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL-------ECLLAQKKDIKRKLI 414 C LCL P+ DP GH FC +C+L EC L + K + +L+ Sbjct: 245 CMLCLSPMKDPSCGECGHVFCWKCVLDWVKERQECPLCRAKMRESQLL 292
>RAD5_DEBHA (Q6BIP2) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1153 Score = 35.8 bits (81), Expect = 0.10 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +1 Query: 178 HSKNNNDLAFFTYEEKRKLGYGTQRERLGKDSIKPFDACCLCLK---PLIDPLACPKGHT 348 H+ NN+D F E R + + + K+S C +C + PL + P GH Sbjct: 883 HADNNHDEKFKNNTEVRSVMFPLYEKIDLKES-----ECSICTQSPIPLGEMALTPCGHA 937 Query: 349 FCKECILECLLAQKKDIKRKL 411 +C C+LE Q+K++++ L Sbjct: 938 YCLNCVLEHFDFQEKNLQKPL 958
>PZRN4_HUMAN (Q6ZMN7) PDZ domain-containing RING finger protein 4 (Ligand of| Numb-protein X 4) (SEMACAP3-like protein) Length = 1036 Score = 35.4 bits (80), Expect = 0.13 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 +++ P C LC + L +PL P GH FC C+L + +++ Sbjct: 10 EAVDPALECKLCGQVLEEPLCTPCGHVFCASCLLPWAVRRRR 51
>RAD5_CANAL (Q5ACX1) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1084 Score = 35.0 bits (79), Expect = 0.17 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 274 IKPFDACCLCLK---PLIDPLACPKGHTFCKECILECLLAQKKDIKRKL 411 IK + C +C + P + + P HTFC CILE L QK+ K KL Sbjct: 810 IKEENECSICTQVPIPYSEMVVTPCAHTFCLSCILEHLDFQKELKKEKL 858
>PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10) (AthPEX10)| (Pex10p) (PER8) Length = 381 Score = 35.0 bits (79), Expect = 0.17 Identities = 23/62 (37%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 244 TQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILE-CLLAQKKDIKRKLIAH 420 T E +GK C LCL P A P GH FC CI+E C Q+ + R H Sbjct: 319 TSTEAVGK--------CTLCLSTRQHPTATPCGHVFCWSCIMEWCNEKQECPLCRTPNTH 370 Query: 421 DS 426 S Sbjct: 371 SS 372
>TRIM7_MOUSE (Q923T7) Tripartite motif protein 7 (Glycogenin-interacting| protein) Length = 510 Score = 34.7 bits (78), Expect = 0.22 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILEC 375 C +CL+ +P++ GH+FC+ CI+ C Sbjct: 29 CSICLEFFREPVSVECGHSFCRACIMRC 56
>CWC24_EMENI (Q5AVC5) Pre-mRNA-splicing factor cwc24| Length = 332 Score = 34.3 bits (77), Expect = 0.29 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 280 PFDACCLCLKPLIDPLACPKGHTFCKECILE 372 PF AC +C KP +P+ GH FC+ C L+ Sbjct: 238 PF-ACIICKKPYQNPIVTKCGHYFCESCALQ 267
>TRI43_HUMAN (Q96BQ3) Tripartite motif protein 43| Length = 446 Score = 33.9 bits (76), Expect = 0.38 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL L+DP+ GH+FC+ C+ Sbjct: 15 CVICLNYLVDPVTICCGHSFCRPCL 39
>RAG1_CHICK (P24271) V(D)J recombination-activating protein 1 (RAG-1)| Length = 1041 Score = 33.5 bits (75), Expect = 0.50 Identities = 21/65 (32%), Positives = 28/65 (43%) Frame = +1 Query: 184 KNNNDLAFFTYEEKRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKEC 363 KN N + T + R L D IK +C +C L DP+ H FC+ C Sbjct: 254 KNKNVMKEITNCKNRHLSTKLLAVDYPADFIKSI-SCQICEHILADPVETTCRHLFCRTC 312 Query: 364 ILECL 378 IL C+ Sbjct: 313 ILSCI 317
>TRI17_RAT (Q9WV59) Tripartite motif protein 17 (Testis RING finger protein)| Length = 477 Score = 33.5 bits (75), Expect = 0.50 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL DP+ GH FC+ECI Sbjct: 16 CSICLDYFTDPVMTACGHNFCRECI 40
>TRI17_MOUSE (Q7TPM3) Tripartite motif protein 17| Length = 477 Score = 33.5 bits (75), Expect = 0.50 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL DP+ GH FC+ECI Sbjct: 16 CSICLDYFTDPVMTACGHNFCRECI 40
>TRIM6_MOUSE (Q8BGE7) Tripartite motif protein 6| Length = 488 Score = 33.5 bits (75), Expect = 0.50 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL 369 C +CL+ L +PL+ GH+FC+ CI+ Sbjct: 15 CPICLELLTEPLSIDCGHSFCQVCII 40
>PEX10_YEAST (Q05568) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 337 Score = 33.5 bits (75), Expect = 0.50 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL 369 C LCL + DP P GH FC C++ Sbjct: 286 CILCLMNMSDPSCAPCGHLFCWSCLM 311
>TRIM7_HUMAN (Q9C029) Tripartite motif protein 7 (Glycogenin-interacting| protein) (RING finger protein 90) Length = 511 Score = 33.5 bits (75), Expect = 0.50 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 229 KLGYGTQRERLGKDSIKPFDACC-LCLKPLIDPLACPKGHTFCKECILEC 375 + G GT E L + +A C +CL+ +P++ GH+FC+ CI C Sbjct: 7 RTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRC 56
>TRI25_MOUSE (Q61510) Tripartite motif protein 25 (Zinc finger protein 147)| (Estrogen-responsive finger protein) (Efp) Length = 634 Score = 33.1 bits (74), Expect = 0.65 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECLLAQ 387 +C +CL+ +P+ P GH FC C+ E + Q Sbjct: 12 SCSVCLELFKEPVTTPCGHNFCTSCLDETWVVQ 44
>TRI22_HUMAN (Q8IYM9) Tripartite motif protein 22 (RING finger protein 94) (50| kDa-stimulated trans-acting factor) (Staf-50) Length = 498 Score = 33.1 bits (74), Expect = 0.65 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ L +PL+ GH+FC+ CI Sbjct: 15 CPICLELLTEPLSLDCGHSFCQACI 39
>TRIM6_HUMAN (Q9C030) Tripartite motif protein 6 (RING finger protein 89)| Length = 488 Score = 33.1 bits (74), Expect = 0.65 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ L +PL+ GH+FC+ CI Sbjct: 15 CPICLELLTEPLSIDCGHSFCQACI 39
>TRI12_MOUSE (Q99PQ1) Tripartite motif protein 12| Length = 284 Score = 32.7 bits (73), Expect = 0.85 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 271 SIKPFDACCLCLKPLIDPLACPKGHTFCKECI 366 ++K C +CL ++ P++ GHTFC+ CI Sbjct: 8 NLKEEVTCPVCLNLMVKPVSADCGHTFCQGCI 39
>RN141_CHICK (Q5ZM74) RING finger protein 141| Length = 230 Score = 32.7 bits (73), Expect = 0.85 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECI 366 D CC+C+ +D L P H+FC++CI Sbjct: 153 DECCICMDGRVD-LILPCAHSFCQKCI 178
>A33_PLEWA (Q02084) Zinc-binding protein A33| Length = 624 Score = 32.7 bits (73), Expect = 0.85 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Frame = +1 Query: 223 KRKL--GYGTQRERLGKDSIKPFD---ACCLCLKPLIDPLACPKGHTFCKECI 366 KRK+ G G Q++R D F C LC +P+ GH FCK CI Sbjct: 134 KRKIEDGDGDQKKRKVDDEEDDFTEDLTCPLCRSLFKEPVILECGHNFCKHCI 186
>TRI56_MOUSE (Q80VI1) Tripartite motif protein 56| Length = 734 Score = 32.7 bits (73), Expect = 0.85 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 229 KLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILE 372 K+ T E L D F AC +CL+ L P P HT+C++C+ + Sbjct: 4 KVSSPTLLEALSSD----FLACKICLEQLHTPKTLPCLHTYCQDCLAQ 47
>RN125_HUMAN (Q96EQ8) RING finger protein 125 (EC 6.3.2.-) (T-cell RING| activation protein 1) (TRAC-1) Length = 231 Score = 32.7 bits (73), Expect = 0.85 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 247 QRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 +R R + + FD C +CL+ L P+ GH FC+ CI L K Sbjct: 22 ERRRDPELPVTSFD-CAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNK 68
>TRAF6_MOUSE (P70196) TNF receptor-associated factor 6| Length = 530 Score = 32.7 bits (73), Expect = 0.85 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECL 378 C +CL L + + P GH FCK CI++ + Sbjct: 70 CPICLMALREAVQTPCGHRFCKACIIKSI 98
>PCGF6_HUMAN (Q9BYE7) Polycomb group RING finger protein 6 (RING finger protein| 134) (Mel18 and Bmi1-like RING finger) Length = 352 Score = 32.7 bits (73), Expect = 0.85 Identities = 19/91 (20%), Positives = 38/91 (41%), Gaps = 3/91 (3%) Frame = +1 Query: 163 KMPQRHSKNNNDLAFFTY--EEKRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACP 336 ++ + + D++ F+ E R+ + + + P+ C +C LID Sbjct: 91 ELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTPYILCSICKGYLIDATTIT 150 Query: 337 KG-HTFCKECILECLLAQKKDIKRKLIAHDS 426 + HTFCK CI+ + K ++ H + Sbjct: 151 ECLHTFCKSCIVRHFYYSNRCPKCNIVVHQT 181
>TRAF6_HUMAN (Q9Y4K3) TNF receptor-associated factor 6 (Interleukin 1 signal| transducer) (RING finger protein 85) Length = 522 Score = 32.7 bits (73), Expect = 0.85 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECL 378 C +CL L + + P GH FCK CI++ + Sbjct: 70 CPICLMALREAVQTPCGHRFCKACIIKSI 98
>TRAF7_HUMAN (Q6Q0C0) E3 ubiquitin protein ligase TRAF7 (EC 6.3.2.-) (TNF| receptor-associated factor 7) (Ring finger and WD repeat domain 1) (RING finger protein 119) Length = 670 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKKDIKRKLIAHD 423 C LC DP+ GHTFC+ C L+ ++K ++ ++ Sbjct: 131 CQLCCSVFKDPVITTCGHTFCRRCALKSEKCPVDNVKLTVVVNN 174
>TRIM5_HUMAN (Q9C035) Tripartite motif protein 5 (EC 6.3.2.-) (RING finger| protein 88) Length = 493 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 271 SIKPFDACCLCLKPLIDPLACPKGHTFCKECI 366 ++K C +CL+ L PL+ GH+FC+ C+ Sbjct: 8 NVKEEVTCPICLELLTQPLSLDCGHSFCQACL 39
>TRI39_HUMAN (Q9HCM9) Tripartite motif protein 39 (RING finger protein 23)| (Testis-abundant finger protein) Length = 518 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECI 366 +C +CL+ L +P+ GH FCK CI Sbjct: 28 SCSVCLEYLKEPVIIECGHNFCKACI 53
>RAG1_RABIT (P34088) V(D)J recombination-activating protein 1 (RAG-1)| Length = 1042 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECL 378 +C +C L DP+ H FC+ CIL CL Sbjct: 291 SCQICEHILADPVETSCKHVFCRICILRCL 320
>RAG1_PIG (Q867B5) V(D)J recombination-activating protein 1 (RAG-1)| Length = 1043 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECL 378 +C +C L DP+ H FC+ CIL CL Sbjct: 292 SCQICEHILADPVETSCKHVFCRICILRCL 321
>RAG1_HUMAN (P15918) V(D)J recombination-activating protein 1 (RAG-1) (RING| finger protein 74) Length = 1043 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECL 378 +C +C L DP+ H FC+ CIL CL Sbjct: 292 SCQICEHILADPVETNCKHVFCRVCILRCL 321
>TRI39_RAT (Q6MFZ5) Tripartite motif protein 39 (RING finger protein 23)| Length = 488 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECI 366 +C +CL+ L +P+ GH FCK CI Sbjct: 28 SCSVCLEYLKEPVIIECGHNFCKACI 53
>TRI39_MOUSE (Q9ESN2) Tripartite motif protein 39 (RING finger protein 23)| (Testis-abundant finger protein) Length = 488 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECI 366 +C +CL+ L +P+ GH FCK CI Sbjct: 28 SCSVCLEYLKEPVIIECGHNFCKACI 53
>SMRA3_HUMAN (Q14527) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (DNA binding protein/plasminogen activator inhibitor 1 regulator) (Helicase-like tran Length = 1009 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECILECLLAQKKDIKRKLIAHD 423 + C +CL L P+ H FCK CI + + ++ K L +D Sbjct: 758 EECAICLDSLTVPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRND 803
>BRCA1_BOVIN (Q864U1) Breast cancer type 1 susceptibility protein homolog| Length = 1849 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQKK 56
>RAG1_MOUSE (P15919) V(D)J recombination-activating protein 1 (RAG-1)| Length = 1040 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECL 378 +C +C L DP+ H FC+ CIL CL Sbjct: 289 SCQICEHILADPVETSCKHLFCRICILRCL 318
>BRCA1_MOUSE (P48754) Breast cancer type 1 susceptibility protein homolog| Length = 1812 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQKK 56
>BRCA1_PONPY (Q6J6J0) Breast cancer type 1 susceptibility protein homolog| Length = 1863 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQKK 56
>BRCA1_PANTR (Q9GKK8) Breast cancer type 1 susceptibility protein homolog| Length = 1863 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQKK 56
>BRCA1_HUMAN (P38398) Breast cancer type 1 susceptibility protein (RING finger| protein 53) Length = 1863 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQKK 56
>BRCA1_GORGO (Q6J6I8) Breast cancer type 1 susceptibility protein homolog| Length = 1863 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQKK 56
>BFAR_MOUSE (Q8R079) Bifunctional apoptosis regulator| Length = 450 Score = 32.0 bits (71), Expect = 1.4 Identities = 19/67 (28%), Positives = 31/67 (46%) Frame = +1 Query: 193 NDLAFFTYEEKRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILE 372 NDL+ EE+ + R + S+ F C C L++P GH+FC+ C+ Sbjct: 7 NDLSMREQEEEHPV-----RSSGPQISVSEFSCHC-CYDTLVNPTTLNCGHSFCRHCLAL 60 Query: 373 CLLAQKK 393 ++ KK Sbjct: 61 WWMSSKK 67
>TRI49_HUMAN (Q9NS80) Tripartite motif protein 49 (RING finger protein 18)| (Testis-specific ring-finger protein) Length = 452 Score = 32.0 bits (71), Expect = 1.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C LC+ IDP+ GH+FC+ C Sbjct: 15 CPLCMNYFIDPVTIDCGHSFCRPC 38
>RN125_MACFA (Q95KF1) RING finger protein 125 (EC 6.3.2.-)| Length = 231 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 274 IKPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 + FD C +CL+ L P+ GH FC+ CI L K Sbjct: 31 VTSFD-CAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNK 68
>PEX10_PICPA (Q92265) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (Peroxisome assembly protein PAS7) Length = 419 Score = 32.0 bits (71), Expect = 1.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C LCL + +P A GH FC CI++ Sbjct: 298 CMLCLSYMTNPTAANCGHCFCWSCIID 324
>SM3L3_ARATH (Q9FIY7) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 3 (EC 3.6.1.-) (SMARCA3-like protein 3) Length = 1277 Score = 32.0 bits (71), Expect = 1.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL 369 C +CL+ DP+ P H C+EC+L Sbjct: 1040 CPICLESADDPVLTPCAHRMCRECLL 1065
>BRCA1_RAT (O54952) Breast cancer type 1 susceptibility protein homolog| Length = 1817 Score = 32.0 bits (71), Expect = 1.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTQCDHIFCKFCMLK-LLNQKK 56
>CWC24_SCHPO (Q9P6R8) Pre-mRNA-splicing factor cwc24 (Complexed with cdc5| protein 24) (Cell cycle control protein cwf24) Length = 533 Score = 31.6 bits (70), Expect = 1.9 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 214 YEEKRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECIL 369 Y++ KL G + +D PF C +C K P+A GH FC++C + Sbjct: 231 YKKGAKLEEGMVKNEKKEDI--PF-VCLICKKDYRSPIATTCGHHFCEQCAI 279
>SMRA3_MOUSE (Q6PCN7) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (TNF-response element-binding protein) (P113) Length = 1003 Score = 31.6 bits (70), Expect = 1.9 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECILECLLAQKKDIKRKLIAHD 423 + C +CL L P+ H FCK CI + + +++ K L ++ Sbjct: 752 EECAICLDSLTFPVITHCAHVFCKPCICQVIHSEQPHAKCPLCRNE 797
>PPIL2_MOUSE (Q9D787) Peptidyl-prolyl cis-trans isomerase-like 2 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-60) (Cyclophilin-like protein Cyp-60) Length = 521 Score = 31.6 bits (70), Expect = 1.9 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 238 YGTQRERLGKDSIK--PFDACCLCLKPLIDPLACPKGHTF 351 YG ++ + + S + PFD C L L+P + P+ P+G F Sbjct: 22 YGGRKPDISQTSFRRLPFDHCSLSLQPFVYPVCTPEGVVF 61
>TRI41_HUMAN (Q8WV44) Tripartite motif protein 41| Length = 630 Score = 31.6 bits (70), Expect = 1.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C +CL DP++ GH FC+ C+ + Sbjct: 20 CAICLDYFTDPVSIGCGHNFCRVCVTQ 46
>TRI56_HUMAN (Q9BRZ2) Tripartite motif protein 56 (RING finger protein 109)| Length = 755 Score = 31.6 bits (70), Expect = 1.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 283 FDACCLCLKPLIDPLACPKGHTFCKECILE 372 F AC +CL+ L P P HT+C++C+ + Sbjct: 18 FLACKICLEQLRAPKTLPCLHTYCQDCLAQ 47
>TRAF7_MOUSE (Q922B6) E3 ubiquitin protein ligase TRAF7 (EC 6.3.2.-) (TNF| receptor-associated factor 7) Length = 594 Score = 31.6 bits (70), Expect = 1.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C LC DP+ GHTFC+ C L+ Sbjct: 55 CQLCCSVFKDPVITTCGHTFCRRCALK 81
>TRI35_HUMAN (Q9UPQ4) Tripartite motif protein 35 (Hemopoeitic lineage switch| protein 5) Length = 493 Score = 31.2 bits (69), Expect = 2.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILEC 375 C +C P D + GH FC+ C+ C Sbjct: 21 CAVCYDPFRDAVTLRCGHNFCRGCVSRC 48
>TRI26_PANTR (Q7YR34) Tripartite motif protein 26 (Zinc finger protein 173)| Length = 539 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C +CL L DP+ GH FC+ C Sbjct: 16 CSICLDYLRDPVTIDCGHVFCRSC 39
>TRI26_HUMAN (Q12899) Tripartite motif protein 26 (Zinc finger protein 173)| (Acid finger protein) (AFP) (RING finger protein 95) Length = 539 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C +CL L DP+ GH FC+ C Sbjct: 16 CSICLDYLRDPVTIDCGHVFCRSC 39
>TRI17_HUMAN (Q9Y577) Tripartite motif protein 17 (Testis RING finger protein)| (RING finger protein 16) Length = 477 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL DP+ GH FC+ CI Sbjct: 16 CSICLDYFTDPVMTTCGHNFCRACI 40
>TRI48_HUMAN (Q8IWZ4) Tripartite motif protein 48 (RING finger protein 101)| Length = 375 Score = 31.2 bits (69), Expect = 2.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C +C+ IDP+ GH+FC+ C Sbjct: 15 CPICMNYFIDPVTIDCGHSFCRPC 38
>TRI52_HUMAN (Q96A61) Tripartite motif protein 52 (RING finger protein 102)| Length = 297 Score = 31.2 bits (69), Expect = 2.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C +CL DP++ GH FC+ C+ + Sbjct: 20 CAICLDYFKDPVSISCGHNFCRGCVTQ 46
>TRI35_MOUSE (Q8C006) Tripartite motif protein 35 (Macrophage-derived| apoptosis-inducing RBCC protein) (MAIR protein) (Nc8 protein) (Hemopoeitic lineage switch protein 5) Length = 501 Score = 31.2 bits (69), Expect = 2.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILEC 375 C +C P D + GH FC+ C+ C Sbjct: 21 CAVCYDPFRDAVTLRCGHNFCRRCVSGC 48
>TRI50_MOUSE (Q810I2) Tripartite motif protein 50| Length = 483 Score = 31.2 bits (69), Expect = 2.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ +PL GH++CK+C+ Sbjct: 16 CPICLEVFKEPLMLQCGHSYCKDCL 40
>TRI34_HUMAN (Q9BYJ4) Tripartite motif protein 34 (Interferon-responsive finger| protein 1) (RING finger protein 21) Length = 488 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ L +PL+ GH+ C+ CI Sbjct: 15 CPICLELLTEPLSLDCGHSLCRACI 39
>TRI26_RAT (P62603) Tripartite motif protein 26 (Zinc finger protein 173)| Length = 542 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C +CL L DP+ GH FC+ C Sbjct: 16 CSICLDYLRDPVTIDCGHVFCRSC 39
>TRI26_PIG (O77666) Tripartite motif protein 26 (Zinc finger protein 173)| Length = 545 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C +CL L DP+ GH FC+ C Sbjct: 16 CSICLDYLRDPVTIDCGHVFCRSC 39
>TRI26_MOUSE (Q99PN3) Tripartite motif protein 26 (Zinc finger protein 173)| Length = 545 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKEC 363 C +CL L DP+ GH FC+ C Sbjct: 16 CSICLDYLRDPVTIDCGHVFCRSC 39
>RNF39_RAT (Q920M2) RING finger protein 39 (LTP-induced RING finger protein)| Length = 352 Score = 31.2 bits (69), Expect = 2.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPKGHTFCKECILEC 375 + ++ C LC P DP+ H+FC+ C+ C Sbjct: 12 ERLEQLATCPLCGGPFEDPVLLACEHSFCRSCLARC 47
>RN125_MOUSE (Q9D9R0) RING finger protein 125 (EC 6.3.2.-)| Length = 232 Score = 31.2 bits (69), Expect = 2.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 274 IKPFDACCLCLKPLIDPLACPKGHTFCKECI 366 I FD C +CL+ L P+ GH FC+ CI Sbjct: 31 ITSFD-CSVCLEVLHQPVRTRCGHVFCRSCI 60
>ZN179_HUMAN (Q9ULX5) Zinc finger protein 179 (Brain finger protein) (RING| finger protein 112) Length = 632 Score = 31.2 bits (69), Expect = 2.5 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 259 LGKDSIKPFD--ACCLCLKPLIDPLACPKGHTFCKEC 363 LG + P + C +CL+ L DP++ GH FC C Sbjct: 44 LGPQPMAPRELPTCSICLERLRDPISLDCGHDFCIRC 80
>BRCA1_CANFA (Q95153) Breast cancer type 1 susceptibility protein homolog| Length = 1878 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FCK C+L+ LL Q+K Sbjct: 24 CPICLELIKEPVSTKCDHIFCKFCMLK-LLNQRK 56
>BRCA1_MACMU (Q6J6I9) Breast cancer type 1 susceptibility protein homolog| Length = 1863 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +CL+ + +P++ H FC+ C+L+ LL QKK Sbjct: 24 CPICLELIKEPVSTKCDHIFCRFCMLK-LLNQKK 56
>TRI30_MOUSE (P15533) Tripartite motif protein 30 (Down regulatory protein of| interleukin 2 receptor) Length = 496 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPKGHTFCKECI 366 + IK C +CL+ L +P++ H+FC+ CI Sbjct: 7 EMIKEEVTCPICLELLKEPVSADCNHSFCRACI 39
>PCGF6_MOUSE (Q99NA9) Polycomb group RING finger protein 6 (RING finger protein| 134) (Mel18 and Bmi1-like RING finger) Length = 353 Score = 30.8 bits (68), Expect = 3.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 274 IKPFDACCLCLKPLIDPLACPKG-HTFCKECILECLLAQKKDIKRKLIAHDS 426 + P+ C +C LID + HTFCK CI+ + K ++ H + Sbjct: 131 LTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQT 182
>BFAR_RAT (Q5PQN2) Bifunctional apoptosis regulator| Length = 450 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 289 ACCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 +C C L++P GH+FC+ C+ ++ KK Sbjct: 33 SCHCCYDTLVNPTTLNCGHSFCRHCLALWWMSSKK 67
>TRIM8_MOUSE (Q99PJ2) Tripartite motif protein 8 (RING finger protein 27)| (Glioblastoma-expressed RING finger protein) Length = 551 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C +CL ++P+ P H FC+ CI E Sbjct: 15 CPICLHVFVEPVQLPCKHNFCRGCIGE 41
>TRIM8_HUMAN (Q9BZR9) Tripartite motif protein 8 (RING finger protein 27)| (Glioblastoma-expressed RING finger protein) Length = 551 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILE 372 C +CL ++P+ P H FC+ CI E Sbjct: 15 CPICLHVFVEPVQLPCKHNFCRGCIGE 41
>TRI50_PIG (Q865W2) Tripartite motif protein 50| Length = 486 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL 369 C +CL+ +PL GH++CK C+L Sbjct: 16 CPVCLEVFKEPLMLQCGHSYCKGCLL 41
>SM3L2_ARATH (Q9FNI6) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 2 (EC 3.6.1.-) (SMARCA3-like protein 2) Length = 1029 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL 369 C +CL+ L D + P H C+EC+L Sbjct: 794 CPICLEALEDAVLTPCAHRLCRECLL 819
>YMW5_YEAST (Q04779) Hypothetical 78.8 kDa protein in ABF2-CHL12 intergenic| region Length = 684 Score = 30.8 bits (68), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 298 LCLKPLIDPLACPKGHTFCKEC 363 LCL P IDP PKG C EC Sbjct: 285 LCLDPPIDPNNLPKGDWHCNEC 306
>PCGF6_RAT (Q5XI70) Polycomb group RING finger protein 6 (RING finger protein| 134) Length = 351 Score = 30.8 bits (68), Expect = 3.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 274 IKPFDACCLCLKPLIDPLACPKG-HTFCKECILECLLAQKKDIKRKLIAHDS 426 + P+ C +C LID + HTFCK CI+ + K ++ H + Sbjct: 129 LTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQT 180
>TRIM2_MOUSE (Q9ESN6) Tripartite motif protein 2 (Neural activity-related RING| finger protein) Length = 744 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 277 KPFDACCLCLKPLIDPLACPKGHTFCKECI 366 K F C +CL+ +P P HTFC+ C+ Sbjct: 18 KQFLICSICLERYKNPKVLPCLHTFCERCL 47
>TRIM2_HUMAN (Q9C040) Tripartite motif protein 2 (RING finger protein 86)| Length = 744 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 277 KPFDACCLCLKPLIDPLACPKGHTFCKECI 366 K F C +CL+ +P P HTFC+ C+ Sbjct: 18 KQFLICSICLERYKNPKVLPCLHTFCERCL 47
>PEX12_PICPA (Q01961) Peroxisome assembly protein 12 (Peroxin-12) (Peroxisome| assembly protein PAS10) Length = 409 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 253 ERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQKKD 396 ++L K S C LC K + +P G+ FC CI + L + + D Sbjct: 326 KKLLKKSQSNDGTCPLCHKQITNPAVIETGYVFCYTCIFKHLTSSELD 373
>NF7O_XENLA (Q91431) Nuclear factor 7, ovary (xNF7-O)| Length = 610 Score = 30.4 bits (67), Expect = 4.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C LC++ DP+ GH FC+ CI Sbjct: 146 CPLCVELFKDPVMVACGHNFCRSCI 170
>TRI50_RAT (Q810I1) Tripartite motif protein 50| Length = 483 Score = 30.4 bits (67), Expect = 4.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ +PL GH++CK C+ Sbjct: 16 CPICLEVFKEPLMLQCGHSYCKNCL 40
>NF7B_XENLA (Q92021) Nuclear factor 7, brain (xNF7) (xNF7-B)| Length = 609 Score = 30.4 bits (67), Expect = 4.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C LC++ DP+ GH FC+ CI Sbjct: 145 CPLCVELFKDPVMVACGHNFCRSCI 169
>TRIM3_HUMAN (O75382) Tripartite motif protein 3 (RING finger protein 22)| (Brain-expressed RING finger protein) (RING finger protein 97) Length = 744 Score = 30.4 bits (67), Expect = 4.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 277 KPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQ 387 K F C +CL P P HTFC+ C+ + AQ Sbjct: 17 KQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQ 53
>RAD18_CANGA (Q6FPI4) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 411 Score = 30.0 bits (66), Expect = 5.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +C L +P+ P GHTFC CI Sbjct: 27 CHICKDFLKNPVLTPCGHTFCSLCI 51
>RAD5_ASHGO (Q753V5) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1085 Score = 30.0 bits (66), Expect = 5.5 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPK----GHTFCKECILECLLAQKK 393 D++K + C +C I PL GH FC+ C+LE + Q K Sbjct: 825 DALKDLE-CSICTCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNK 869
>TRI50_HUMAN (Q86XT4) Tripartite motif protein 50| Length = 487 Score = 30.0 bits (66), Expect = 5.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECIL 369 C +CL+ +PL GH++CK C++ Sbjct: 16 CPICLEVFKEPLMLQCGHSYCKGCLV 41
>ZN179_RAT (O70418) Zinc finger protein 179 (Brain finger protein)| Length = 631 Score = 30.0 bits (66), Expect = 5.5 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 223 KRKLGYGTQRERLGKDSIKPFDACCLCLKPLIDPLACPKGHTFCKEC 363 K +LG G QR ++S C +CL+ L +P++ GH FC C Sbjct: 39 KLELGLG-QRPSPPRES----PTCSICLERLREPISLDCGHDFCIRC 80
>RL32_STRAW (Q82JT8) 50S ribosomal protein L32| Length = 57 Score = 30.0 bits (66), Expect = 5.5 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 223 KRKLGYGTQRERLG--KDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILE 372 KRK+ R R K ++ AC C +P + +ACP T+ K +LE Sbjct: 5 KRKMSRSNTRHRRSQWKAAVPTLVACERCHEPKLQHIACPSCGTYNKRQVLE 56
>RN141_RAT (Q6IV57) RING finger protein 141| Length = 230 Score = 29.6 bits (65), Expect = 7.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECI 366 + CC+C+ D L P H+FC++CI Sbjct: 153 EECCICMDGRAD-LILPCAHSFCQKCI 178
>RN141_PONPY (Q5R7K8) RING finger protein 141| Length = 230 Score = 29.6 bits (65), Expect = 7.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECI 366 + CC+C+ D L P H+FC++CI Sbjct: 153 EECCICMDGRAD-LILPCAHSFCQKCI 178
>RN141_MOUSE (Q99MB7) RING finger protein 141 (Zinc finger protein 230)| Length = 230 Score = 29.6 bits (65), Expect = 7.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECI 366 + CC+C+ D L P H+FC++CI Sbjct: 153 EECCICMDGRAD-LILPCAHSFCQKCI 178
>RN141_HUMAN (Q8WVD5) RING finger protein 141 (Zinc finger protein 230)| Length = 230 Score = 29.6 bits (65), Expect = 7.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECI 366 + CC+C+ D L P H+FC++CI Sbjct: 153 EECCICMDGRAD-LILPCAHSFCQKCI 178
>TRI27_MOUSE (Q62158) Zinc-finger protein RFP (Ret finger protein) (Tripartite| motif protein 27) Length = 513 Score = 29.6 bits (65), Expect = 7.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKKDI 399 C +CL+ ++P+ GH C C+ C A + ++ Sbjct: 16 CPVCLQYFVEPMMLDCGHNICCACLARCWGAAETNV 51
>CWC24_CRYNE (Q5KB05) Pre-mRNA-splicing factor CWC24| Length = 329 Score = 29.6 bits (65), Expect = 7.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 280 PFDACCLCLKPLIDPLACPKGHTFCKEC 363 PF AC +C +P P+ GH FC C Sbjct: 234 PF-ACLICRQPFTQPVVTKCGHYFCMGC 260
>V002_FOWPV (Q9ICF9) Hypothetical protein FPV002/FPV259| Length = 222 Score = 29.6 bits (65), Expect = 7.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 280 PFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQK 390 PF+ CC C+ +D L H+ C C+L L+ ++ Sbjct: 39 PFEVCCECMSETLDSLE----HSCCYCCVLPLLIIRE 71
>RN146_MOUSE (Q9CZW6) RING finger protein 146| Length = 359 Score = 29.6 bits (65), Expect = 7.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ + P++ P H FC C+ Sbjct: 38 CAICLQTCVHPVSLPCKHVFCYLCV 62
>RN146_HUMAN (Q9NTX7) RING finger protein 146 (Dactylidin)| Length = 359 Score = 29.6 bits (65), Expect = 7.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ + P++ P H FC C+ Sbjct: 37 CAICLQTCVHPVSLPCKHVFCYLCV 61
>RN141_BRARE (Q6IV56) RING finger protein 141| Length = 222 Score = 29.6 bits (65), Expect = 7.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECI 366 + CC+C+ D L P H+FC++CI Sbjct: 145 EECCICMDGKAD-LILPCAHSFCQKCI 170
>CWC24_USTMA (Q4P400) Pre-mRNA-splicing factor CWC24| Length = 355 Score = 29.6 bits (65), Expect = 7.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 280 PFDACCLCLKPLIDPLACPKGHTFCKECILE 372 PF AC +C K DP+ H FC C ++ Sbjct: 261 PF-ACLICRKAFTDPVVTRCAHYFCSSCAIK 290
>RN146_PONPY (Q5REL3) RING finger protein 146| Length = 358 Score = 29.6 bits (65), Expect = 7.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ + P++ P H FC C+ Sbjct: 36 CAICLQTCVHPVSLPCKHVFCYLCV 60
>PPIL2_HUMAN (Q13356) Peptidyl-prolyl cis-trans isomerase-like 2 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-60) (Cyclophilin-like protein Cyp-60) Length = 520 Score = 29.6 bits (65), Expect = 7.2 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +1 Query: 238 YGTQRERLGKDSIK--PFDACCLCLKPLIDPLACPKGHTF 351 YG ++ L + + + PFD C L L+P + P+ P G F Sbjct: 22 YGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVF 61
>NHL1_CAEEL (Q03601) RING finger protein nhl-1| Length = 974 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 268 DSIKPFDACCLCLKPLIDPLACPKGHTFCKECILECLLAQKKDIK 402 + I+ C +CL P P HTFC C+ C +++K Sbjct: 35 EKIEQLLTCPICLDRYKQPKLLPCQHTFCYPCLESCADTLHRNLK 79
>RN146_RAT (Q5XIK5) RING finger protein 146| Length = 352 Score = 29.6 bits (65), Expect = 7.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL+ + P++ P H FC C+ Sbjct: 36 CAICLQTCVHPVSLPCKHVFCYLCV 60
>CM007_MOUSE (Q8K2Y0) Protein C13orf7 homolog| Length = 722 Score = 29.6 bits (65), Expect = 7.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL + P+ C H FC CI Sbjct: 18 CHICLGKVRQPVVCTNNHVFCSICI 42
>RL321_STRCO (Q9ZBQ8) 50S ribosomal protein L32-1| Length = 56 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 223 KRKLGYGTQRERLG--KDSIKPFDACCLCLKPLIDPLACPKGHTFCKECILE 372 KRK+ R R K ++ AC C +P + +ACP T+ K +LE Sbjct: 4 KRKMSRSNTRHRRSQWKAAVPTLVACERCHEPKLQHIACPACGTYNKRQVLE 55
>TRIM4_HUMAN (Q9C037) Tripartite motif protein 4 (RING finger protein 87)| Length = 500 Score = 29.3 bits (64), Expect = 9.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +CL DP++ GH FC+ C+ Sbjct: 12 CPICLDYFQDPVSIECGHNFCRGCL 36
>RN113_CAEEL (O17917) Putative RING finger protein 113 homolog| Length = 384 Score = 29.3 bits (64), Expect = 9.4 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLAQKK 393 C +C P +DP+ H FC C L+ K Sbjct: 241 CFICGNPFVDPIVTKCKHYFCTGCALKSFQKSSK 274
>TRI40_RAT (Q6MFY8) Tripartite motif protein 40 (RING finger protein 35)| Length = 247 Score = 29.3 bits (64), Expect = 9.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 286 DACCLCLKPLIDPLACPKGHTFCKECIL 369 D C +CL PL + ++ H FC+ C++ Sbjct: 10 DICPICLDPLKEAVSTDCRHLFCRMCLI 37
>TRI18_MUSSP (P82457) Midline-1 (Tripartite motif protein 18)| Length = 667 Score = 29.3 bits (64), Expect = 9.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECILECLLA 384 C +CL+ L DPL P H+ C C L++ Sbjct: 10 CPICLELLEDPLLLPCAHSLCFNCAHRILVS 40
>RFP2_MOUSE (Q9CYB0) Ret finger protein 2 (Putative tumor suppressor RFP2)| (Tripartite motif-containing protein 13) Length = 407 Score = 29.3 bits (64), Expect = 9.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +C DP P H FCK+C+ Sbjct: 10 CPICCSLFDDPRVLPCSHNFCKKCL 34
>RFP2_HUMAN (O60858) Ret finger protein 2 (Leukemia-associated protein 5)| (B-cell chronic lymphocytic leukemia tumor suppressor Leu5) (Putative tumor suppressor RFP2) (Tripartite motif protein 13) (RING finger protein 77) Length = 407 Score = 29.3 bits (64), Expect = 9.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 292 CCLCLKPLIDPLACPKGHTFCKECI 366 C +C DP P H FCK+C+ Sbjct: 10 CPICCSLFDDPRVLPCSHNFCKKCL 34 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,178,313 Number of Sequences: 219361 Number of extensions: 836910 Number of successful extensions: 2594 Number of sequences better than 10.0: 141 Number of HSP's better than 10.0 without gapping: 2565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2593 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)