| Clone Name | bart14e08 |
|---|---|
| Clone Library Name | barley_pub |
>BRCA1_CANFA (Q95153) Breast cancer type 1 susceptibility protein homolog| Length = 1878 Score = 30.8 bits (68), Expect = 2.8 Identities = 21/72 (29%), Positives = 27/72 (37%) Frame = -2 Query: 236 PQGHEQTRVAAQDTEPAVNTDGGEHKTTTHKGQGTANHTGAHECASLGLTNCVSKVARGG 57 P H +T QD EPA G K ++ G+ +H L LTN A Sbjct: 657 PVRHNKTLQLMQDKEPA-----GRAKKSSKPGEQINKRLASHAFPELTLTNVSGFFANYS 711 Query: 56 GEESLQICCSPG 21 Q C +PG Sbjct: 712 SSSKPQECINPG 723
>FBXL7_HUMAN (Q9UJT9) F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat| protein 7) (F-box protein FBL6/FBL7) Length = 491 Score = 30.4 bits (67), Expect = 3.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 377 CPRQCRNWRSRSRSPRLWDHLYLGQHLRAENVRIDRS 487 C R CR W + + PRLW + L E + +DR+ Sbjct: 137 CARVCRRWYNLAWDPRLWRTI----RLTGETINVDRA 169
>SYR_PYRAB (Q9V0V2) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 625 Score = 29.6 bits (65), Expect = 6.2 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 103 LVWASRIASRKLLEVEVKNLSRS 35 LVW S I SRKL E+ VK L R+ Sbjct: 267 LVWESDIVSRKLFEIAVKLLERN 289
>MDC1_PIG (Q767L8) Mediator of DNA damage checkpoint protein 1| Length = 2042 Score = 29.6 bits (65), Expect = 6.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 364 PVSEKPVSKPYRANSGRAVLLLPREAMPWATKNSTSCRTIEPI 236 PV+ KP S+ R + ++ + P A+P A + S T +PI Sbjct: 1520 PVTPKPTSRATRGRARKSSVKTPEPAVPTAAEPQPSASTDQPI 1562
>YKJ7_YEAST (P34245) Hypothetical 15.4 kDa protein in APE1/LAP4-CWP1 intergenic| region Length = 136 Score = 29.3 bits (64), Expect = 8.1 Identities = 17/62 (27%), Positives = 24/62 (38%) Frame = +1 Query: 136 PCPLWVVVLCSPPSVFTAGSVSWAATLVCSCPCGSAQSFYS*CCSLLPKASPRAGAIALP 315 P P V+ + +P ++ W C C S +S CC LPK P A Sbjct: 18 PVPAVVLGVMAPKRAYSTPFGPWPGPAECLWNCPSELRQFSSCCLPLPKLRPPRPTFASL 77 Query: 316 YR 321 +R Sbjct: 78 WR 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,524,870 Number of Sequences: 219361 Number of extensions: 1610411 Number of successful extensions: 4680 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4677 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)