| Clone Name | bart14b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ANDR_PIG (Q9GKL7) Androgen receptor (Dihydrotestosterone receptor) | 30 | 1.8 | 2 | SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1 | 28 | 7.0 | 3 | H11_HUMAN (Q02539) Histone H1.1 | 28 | 9.1 | 4 | PRM2_BOVIN (P19782) Protamine-2 (Protamine-P2) (Sperm histone P2) | 28 | 9.1 | 5 | EVI2B_MOUSE (Q8VD58) EVI2B protein precursor (Ecotropic viral in... | 28 | 9.1 |
|---|
>ANDR_PIG (Q9GKL7) Androgen receptor (Dihydrotestosterone receptor)| Length = 896 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 43 QKASPPCIPVPACTSVPSASGSASKNLR 126 Q+++P C P CT P A+ +ASK L+ Sbjct: 104 QQSAPECHPESGCTPEPGAASAASKGLQ 131
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 28.1 bits (61), Expect = 7.0 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +1 Query: 1 SPAASGRSRRLRYSQKASPPCIPVPACTSVPSASGSASKN 120 SP+AS RR R S ASPP P P + P S A K+ Sbjct: 386 SPSASPPRRRHRPSPPASPP--PKPRRSPTPQQSNRARKS 423
>H11_HUMAN (Q02539) Histone H1.1| Length = 214 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 10 ASGRSRRLRYSQKASPPCIPVPACTSVPSASGSASKNLRIPR 135 A+G S++L+ + AS + P P+A+ +SKN + P+ Sbjct: 131 ATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPK 172
>PRM2_BOVIN (P19782) Protamine-2 (Protamine-P2) (Sperm histone P2)| Length = 112 Score = 27.7 bits (60), Expect = 9.1 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +1 Query: 7 AASGRSRRLRYSQKASPPCIPVPACTSVPSASGSASKNLRIPRR 138 A RSRR A PPC P+P T S GS + +R RR Sbjct: 68 ACRHRSRR----GAAGPPCAPIPG-TPQASRQGSGCRRMRRRRR 106
>EVI2B_MOUSE (Q8VD58) EVI2B protein precursor (Ecotropic viral integration site| 2B protein) Length = 444 Score = 27.7 bits (60), Expect = 9.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 37 YSQKASPPCIPVPACTSVPSASGSASKN 120 Y Q+ +PP P P + PS G+A KN Sbjct: 172 YLQRDTPPPPPPPLTSEPPSGKGTAHKN 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.125 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,669,866 Number of Sequences: 219361 Number of extensions: 214015 Number of successful extensions: 771 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)