| Clone Name | bart09f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DNAK_LACSN (Q8KML6) Chaperone protein dnaK (Heat shock protein 7... | 30 | 3.3 | 2 | VPI_BPMU (Q01267) Protein gp32 [Includes: I protein (gpI); Z pro... | 30 | 4.3 | 3 | CARD6_HUMAN (Q9BX69) Caspase recruitment domain-containing prote... | 30 | 4.3 | 4 | DNAK_LACAC (Q84BU4) Chaperone protein dnaK (Heat shock protein 7... | 29 | 5.6 |
|---|
>DNAK_LACSN (Q8KML6) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 614 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 206 RFRSLEVGVREWMAKQPTH-IEAAVTTAFG-AVQGGALGG 319 R +++ V+EW K+P H I A G AVQGG L G Sbjct: 318 RIPAVQEAVKEWSGKEPNHSINPDEAVALGAAVQGGVLTG 357
>VPI_BPMU (Q01267) Protein gp32 [Includes: I protein (gpI); Z protein (gpZ)| (p20)] Length = 361 Score = 29.6 bits (65), Expect = 4.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 136 LLVDNGGAVRVARRGQPAGRADRPLQVAGGRGARVDGE 249 L +D+ G ++ G + R RP V GG+G +DGE Sbjct: 14 LSIDDDGWCQLLPAGHFSARDGRPFDVTGGQGWFIDGE 51
>CARD6_HUMAN (Q9BX69) Caspase recruitment domain-containing protein 6| Length = 1037 Score = 29.6 bits (65), Expect = 4.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 339 PKEGRGSPCRSRLPVSTPRPWPPSSK 416 P + + SPC+S P + +PWPP SK Sbjct: 979 PSQTKPSPCKSTQPKPS-QPWPPQSK 1003
>DNAK_LACAC (Q84BU4) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 614 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 206 RFRSLEVGVREWMAKQPTH-IEAAVTTAFG-AVQGGALGG 319 R +++ V+EW K+P H I A G A+QGG + G Sbjct: 316 RIPAVQKAVKEWAGKEPDHSINPDEAVALGAAIQGGVISG 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.136 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,498,423 Number of Sequences: 219361 Number of extensions: 789764 Number of successful extensions: 3312 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3308 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)