| Clone Name | bart09d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IP3KB_HUMAN (P27987) Inositol-trisphosphate 3-kinase B (EC 2.7.1... | 33 | 0.55 | 2 | MILK1_HUMAN (Q8N3F8) Molecule interacting with Rab13 (MIRab13) (... | 29 | 6.1 | 3 | CR015_HUMAN (Q96N68) Protein C18orf15 | 29 | 7.9 | 4 | PMP8_CHLPN (Q9Z393) Probable outer membrane protein pmp8 precurs... | 29 | 7.9 | 5 | Y3662_YERPE (Q8ZAW9) UPF0190 protein YPO3662/y0205/YP3884 | 29 | 7.9 | 6 | Y3568_YERPS (Q665F0) UPF0190 protein YPTB3568 | 29 | 7.9 |
|---|
>IP3KB_HUMAN (P27987) Inositol-trisphosphate 3-kinase B (EC 2.7.1.127) (Inositol| 1,4,5-trisphosphate 3-kinase B) (IP3K B) (IP3 3-kinase B) (IP3K-B) Length = 946 Score = 32.7 bits (73), Expect = 0.55 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -2 Query: 407 PGRSKVR--RSEPGRRQSWQATCPDTSTVETGSSPYPAMRAS 288 PGR V+ RSE R +SW CP+TS ++G P++ +S Sbjct: 187 PGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSS 228
>MILK1_HUMAN (Q8N3F8) Molecule interacting with Rab13 (MIRab13) (MICAL-like| protein 1) Length = 863 Score = 29.3 bits (64), Expect = 6.1 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 341 PGRSPASSASGQALTFSPSTSQVVRWQ*PAQPKVP 445 PG P+SSA A P S R Q P +P+VP Sbjct: 253 PGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVP 287
>CR015_HUMAN (Q96N68) Protein C18orf15| Length = 181 Score = 28.9 bits (63), Expect = 7.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 492 IAVLICCCKCRVSHRVGTFGCAGYC 418 + V +C C C +HR CAG C Sbjct: 149 VLVCMCACACMRAHRYFLMDCAGIC 173
>PMP8_CHLPN (Q9Z393) Probable outer membrane protein pmp8 precursor| (Polymorphic membrane protein 8) (Outer membrane protein 11) Length = 930 Score = 28.9 bits (63), Expect = 7.9 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 10/47 (21%) Frame = -2 Query: 398 SKVRRSEP--GRRQSWQATCPDTST--------VETGSSPYPAMRAS 288 S V+ EP G + W+AT DTST V TG +P P RAS Sbjct: 564 SPVQTPEPHYGYQGHWEATWADTSTAKSGTMTWVTTGYNPNPERRAS 610
>Y3662_YERPE (Q8ZAW9) UPF0190 protein YPO3662/y0205/YP3884| Length = 366 Score = 28.9 bits (63), Expect = 7.9 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 296 ALPGTARSRSPRCWCPGRSPASSASGQALTFSPSTS 403 ALP +A++ W G P + SG+ LTF+PS + Sbjct: 69 ALPASAQA-DLLAWFKGNEPPKAPSGKPLTFTPSAA 103
>Y3568_YERPS (Q665F0) UPF0190 protein YPTB3568| Length = 366 Score = 28.9 bits (63), Expect = 7.9 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 296 ALPGTARSRSPRCWCPGRSPASSASGQALTFSPSTS 403 ALP +A++ W G P + SG+ LTF+PS + Sbjct: 69 ALPASAQA-DLLAWFKGNEPPKAPSGKPLTFTPSAA 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.130 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,611,790 Number of Sequences: 219361 Number of extensions: 1112094 Number of successful extensions: 3279 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3278 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)