| Clone Name | bart09c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ERG1_ASHGO (Q75F69) Squalene monooxygenase (EC 1.14.99.7) (Squal... | 29 | 5.2 | 2 | RPC1_TRYBB (P08968) DNA-directed RNA polymerase III largest subu... | 29 | 6.8 | 3 | DBP7_KLULA (Q6CK32) ATP-dependent RNA helicase DBP7 (EC 3.6.1.-) | 29 | 6.8 | 4 | MMP24_HUMAN (Q9Y5R2) Matrix metalloproteinase-24 precursor (EC 3... | 29 | 6.8 |
|---|
>ERG1_ASHGO (Q75F69) Squalene monooxygenase (EC 1.14.99.7) (Squalene epoxidase)| (SE) Length = 497 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 161 EEEEQRHGCPGHPHGRFLDSCGALC 87 EE+E+ HG G HGRFL + A+C Sbjct: 139 EEDEREHGV-GFVHGRFLQNLRAIC 162
>RPC1_TRYBB (P08968) DNA-directed RNA polymerase III largest subunit (EC 2.7.7.6)| Length = 1530 Score = 28.9 bits (63), Expect = 6.8 Identities = 22/82 (26%), Positives = 31/82 (37%) Frame = -1 Query: 466 NG*ISNRRDGKEAPSAARSLPSPGAAARKWKKSDSGQEACLSSE*XAAMEPRR*CASRVM 287 +G I+N+R K APS G + + + Q L CAS+ + Sbjct: 1076 SGPIANKRTKKRAPSLKVKDSKEGGRVSELRDLEMLQTELLPLTRGMVTRFIAQCASKYL 1135 Query: 286 AMCTSPGSHTPAAAADGAGHPS 221 PG+ A AA G PS Sbjct: 1136 RKACEPGTPCGAIAAQSVGEPS 1157
>DBP7_KLULA (Q6CK32) ATP-dependent RNA helicase DBP7 (EC 3.6.1.-)| Length = 740 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 303 HYLRGSMAAIYSLLRHASCPESLFFHFLAAAPGDGKLRAALG 428 HY GS + + + SC +S+ FH+ + DG R +G Sbjct: 419 HYKEGSKSDVTRTIVFLSCSDSVDFHYEVFSSHDGNHRGLVG 460
>MMP24_HUMAN (Q9Y5R2) Matrix metalloproteinase-24 precursor (EC 3.4.24.-)| (MMP-24) (Membrane-type matrix metalloproteinase 5) (MT-MMP 5) (Membrane-type-5 matrix metalloproteinase) (MT5-MMP) Length = 645 Score = 28.9 bits (63), Expect = 6.8 Identities = 23/75 (30%), Positives = 30/75 (40%), Gaps = 2/75 (2%) Frame = -1 Query: 445 RDGKEAPSAARSLPSPGAAAR--KWKKSDSGQEACLSSE*XAAMEPRR*CASRVMAMCTS 272 R G+ AP P PG A R +W+ P R + A+C Sbjct: 5 RGGRAAPGPPPPPPPPGQAPRWSRWRV------------------PGRLLLLLLPALCCL 46 Query: 271 PGSHTPAAAADGAGH 227 PG+ AAAA GAG+ Sbjct: 47 PGAARAAAAAAGAGN 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,420,935 Number of Sequences: 219361 Number of extensions: 522521 Number of successful extensions: 1883 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1882 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)