| Clone Name | bart08d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PDLI2_RAT (Q6AYD6) PDZ and LIM domain protein 2 | 32 | 0.38 | 2 | FCA_ARATH (O04425) Flowering time control protein FCA | 28 | 5.5 | 3 | ETR1_TOBAC (O48929) Ethylene receptor (EC 2.7.13.3) (NT-ETR1) | 28 | 7.2 | 4 | PUR4_PASMU (Q9CLW4) Phosphoribosylformylglycinamidine synthase (... | 28 | 7.2 | 5 | SCND2_HUMAN (Q9GZW5) SCAN domain-containing protein 2 | 28 | 7.2 | 6 | PE2R4_RABIT (Q28691) Prostaglandin E2 receptor, EP4 subtype (Pro... | 27 | 9.4 |
|---|
>PDLI2_RAT (Q6AYD6) PDZ and LIM domain protein 2| Length = 349 Score = 32.0 bits (71), Expect = 0.38 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = +3 Query: 12 TSQQARSERGESKSQDSTFLALLSAPGRAQDTRYPSLPRLSS 137 TSQQA G S DST LL +PGR PS PRLSS Sbjct: 179 TSQQA----GHSSPSDSTVRVLLHSPGR------PSSPRLSS 210
>FCA_ARATH (O04425) Flowering time control protein FCA| Length = 747 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 18 QQARSERGESKSQDSTFLALLSAPGRAQDTRYPSLP 125 QQ + + + Q + +L PG + +T+YPSLP Sbjct: 659 QQVQQQYQGQQLQQPFYSSLYPTPGASHNTQYPSLP 694
>ETR1_TOBAC (O48929) Ethylene receptor (EC 2.7.13.3) (NT-ETR1)| Length = 738 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 39 GESKSQDSTFLALLSAPGRAQDTRYPSLPRL 131 G K + F+ L PGR+ + + P +PRL Sbjct: 570 GLGKGSTAIFIVKLGIPGRSNEPKLPFMPRL 600
>PUR4_PASMU (Q9CLW4) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1297 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 33 ERGESKSQDSTFLALLSAPGRAQDTRYPSLPRLSSYLGRGELLL 164 E GE K+ + ++SA R +D R P+L + G LLL Sbjct: 787 ENGEQKTVTAPLSLVISAFARVEDVRKTVTPQLRTDKGHSRLLL 830
>SCND2_HUMAN (Q9GZW5) SCAN domain-containing protein 2| Length = 306 Score = 27.7 bits (60), Expect = 7.2 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 61 RLSSRCSPLQAARRTHATPPSPAFRRTSAE----ASCF*HAGRQRVCCA 195 R S R P Q T PA R ++E ASC AGR R CCA Sbjct: 137 RPSGRTPPAQLRSPWPMTAAGPASRARASETGSTASC---AGRWRTCCA 182
>PE2R4_RABIT (Q28691) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, subtype EP4) Length = 488 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 6 IHTSQQARSERGESKSQDSTFLALLSAPGRAQDTRYPSLPRLSSYLGR 149 +H R+ G + + A+ SA R T P+LPRLS + R Sbjct: 213 MHRQFMRRTSLGTEQHHAAAAAAVTSAACRGHPTASPALPRLSDFRRR 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,447,249 Number of Sequences: 219361 Number of extensions: 518707 Number of successful extensions: 1739 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1737 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)