| Clone Name | bart07e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MMP25_HUMAN (Q9NPA2) Matrix metalloproteinase-25 precursor (EC 3... | 28 | 5.4 | 2 | TIG1_HUMAN (P49788) Retinoic acid receptor responder protein 1 (... | 28 | 7.0 | 3 | H1E_CHITE (P40278) Histone H1E | 27 | 9.2 |
|---|
>MMP25_HUMAN (Q9NPA2) Matrix metalloproteinase-25 precursor (EC 3.4.24.-)| (MMP-25) (Membrane-type matrix metalloproteinase 6) (MT-MMP 6) (Membrane-type-6 matrix metalloproteinase) (MT6-MMP) (Leukolysin) Length = 562 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 117 WRLQPSRSRHQPRASSRPSPWEGRPTAPRL 28 WRLQPS PR + WEG P R+ Sbjct: 340 WRLQPSGQLVSPRPARLHRFWEGLPAQVRV 369
>TIG1_HUMAN (P49788) Retinoic acid receptor responder protein 1| (Tazarotene-induced gene 1 protein) (RAR-responsive protein TIG1) Length = 294 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = -1 Query: 87 QPRASSRPSPWEG----RPTAPRL 28 QPR P+PW G RPTAP L Sbjct: 2 QPRRQRLPAPWSGPRGPRPTAPLL 25
>H1E_CHITE (P40278) Histone H1E| Length = 237 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 258 PKKTAKPVKQEXXXXXXXXXXXXEEIAKKPSAKPATLAAS 377 PK AKP K+ + AKKP+AKPA A+ Sbjct: 194 PKAAAKPKKEVKPKKEAKPKKAAAKPAKKPAAKPAKKPAA 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,930,838 Number of Sequences: 219361 Number of extensions: 208267 Number of successful extensions: 690 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)