| Clone Name | baet99h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloropla... | 49 | 3e-06 | 2 | PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesteras... | 25 | 2.7 | 3 | SYE1_WOLPM (Q73HV5) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Gl... | 29 | 2.8 | 4 | OMPY_CHLPN (Q9Z6M5) Putative outer membrane protein CPn_1034/CP0... | 29 | 3.6 |
|---|
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +2 Query: 179 FVVRASSSPPAKQNDNRQLWFASKQSLT 262 FVVRA+S+PP KQ NRQLWFASKQSL+ Sbjct: 37 FVVRAASTPPVKQGANRQLWFASKQSLS 64
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 24.6 bits (52), Expect(2) = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 192 HRPAPLPSKMTTGSCGS 242 H+P P P + TG CGS Sbjct: 348 HQPLPPPITIATGYCGS 364 Score = 23.1 bits (48), Expect(2) = 2.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 26 PHTPRLPHLSEQQEEELA 79 P T LPH+ E++E + A Sbjct: 320 PQTSPLPHIKEEEESDQA 337
>SYE1_WOLPM (Q73HV5) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Glutamate--tRNA| ligase 1) (GluRS 1) Length = 473 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 198 DDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPW 94 D+ K REE + K C P SC P R W Sbjct: 104 DEVAEKKAKAREEGKIYKHKCTTKPPSCHPSSRHW 138
>OMPY_CHLPN (Q9Z6M5) Putative outer membrane protein| CPn_1034/CP0818/CPj1034/CpB1074 precursor Length = 262 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -1 Query: 222 SFCLAGGLDDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPWAAIVP 79 +F L LDD L G+ + + +GL PE+ W A+VP Sbjct: 41 NFWLILDLDDTLLQGGEALSHSIWKSKAIQGLQKQGTPEQEAWEAVVP 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,689,626 Number of Sequences: 219361 Number of extensions: 359413 Number of successful extensions: 1031 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)