| Clone Name | baet99h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRCB_NEIMB (Q9JZG6) Protein crcB homolog | 31 | 0.81 | 2 | CRCB_NEIMA (Q9JUL1) Protein crcB homolog | 30 | 1.1 | 3 | YNI7_YEAST (P48231) Hypothetical 132.5 kDa protein in TOP2-MKT1 ... | 29 | 2.4 | 4 | RB6I2_HUMAN (Q8IUD2) RAB6-interacting protein 2 (ERC protein 1) | 28 | 4.0 | 5 | RB6I2_MOUSE (Q99MI1) RAB6-interacting protein 2 (ERC protein 1) ... | 28 | 4.0 | 6 | FOXD4_MOUSE (Q60688) Forkhead box protein D4 (Forkhead-related p... | 28 | 5.3 | 7 | FA53C_MOUSE (Q8BXQ8) Protein FAM53C | 27 | 9.0 |
|---|
>CRCB_NEIMB (Q9JZG6) Protein crcB homolog| Length = 119 Score = 30.8 bits (68), Expect = 0.81 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 200 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYLLVLDRTNWKTNMLTGLL 361 LG AR L N A+ F W+ AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWKLLLITGFL 68
>CRCB_NEIMA (Q9JUL1) Protein crcB homolog| Length = 119 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 200 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYLLVLDRTNWKTNMLTGLL 361 LG AR L N A+ F W AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASLSPATGNLFANWTGAFLIGIFAETVNHPQWKLLLITGFL 68
>YNI7_YEAST (P48231) Hypothetical 132.5 kDa protein in TOP2-MKT1 intergenic| region Length = 1178 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 1 STNQTPSPRPSIHPCAELDPHSARLEIFPGLGDSGEDGAVV 123 STN S ++ P + +DP S P +G GEDG V+ Sbjct: 1059 STNSNRSIGKAVVPLSTIDPESDTTFNIPLVGPKGEDGGVL 1099
>RB6I2_HUMAN (Q8IUD2) RAB6-interacting protein 2 (ERC protein 1)| Length = 1116 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 4 TNQTPSPRPSIHPCAELDPHSARLEIFPG 90 TN PSP I P ELD + ++L+++ G Sbjct: 1000 TNHKPSPDQIIQPLLELDQNRSKLKLYIG 1028
>RB6I2_MOUSE (Q99MI1) RAB6-interacting protein 2 (ERC protein 1) (ERC1)| (CAZ-associated structural protein 2) (CAST2) Length = 1120 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 4 TNQTPSPRPSIHPCAELDPHSARLEIFPG 90 TN PSP I P ELD + ++L+++ G Sbjct: 1004 TNHKPSPDQIIQPLLELDQNRSKLKLYIG 1032
>FOXD4_MOUSE (Q60688) Forkhead box protein D4 (Forkhead-related protein FKHL9)| (Forkhead-related transcription factor 5) (FREAC-5) (Transcription factor FKH-2) Length = 444 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 16 PSPRPSIHPCAELDPHSAR--LEIFPGLGDS 102 P+ P HPCA L PH R L P GD+ Sbjct: 246 PAAPPRSHPCAPLHPHPMRYLLLAAPAYGDN 276
>FA53C_MOUSE (Q8BXQ8) Protein FAM53C| Length = 393 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 26 GHPSIPAQSSIRTVRGLRFFQVSAIRGKMAPS 121 G P +P QS + V LRF Q + + AP+ Sbjct: 154 GGPQVPQQSPPKRVSSLRFLQAPSASSQCAPA 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.141 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,082,017 Number of Sequences: 219361 Number of extensions: 535254 Number of successful extensions: 1350 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1350 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)