| Clone Name | baet99d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ITA8_HUMAN (P53708) Integrin alpha-8 precursor [Contains: Integr... | 29 | 3.8 | 2 | CLCN1_MOUSE (Q64347) Chloride channel protein, skeletal muscle (... | 28 | 6.5 | 3 | KCNKC_HUMAN (Q9HB15) Potassium channel subfamily K member 12 (Ta... | 28 | 6.5 | 4 | KCNKC_RAT (Q9ERS1) Potassium channel subfamily K member 12 (Tand... | 28 | 8.4 |
|---|
>ITA8_HUMAN (P53708) Integrin alpha-8 precursor [Contains: Integrin alpha-8| heavy chain; Integrin alpha-8 light chain] Length = 1063 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 184 SPEEMRKPKREAMAALPPICCCCCRLDLPAWSTAGRVF 71 SP R P+ + P+CC L + WS A + F Sbjct: 2 SPGASRGPRGSQAPLIAPLCCAAAALGMLLWSPACQAF 39
>CLCN1_MOUSE (Q64347) Chloride channel protein, skeletal muscle (Chloride| channel protein 1) (ClC-1) Length = 994 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 205 SELXDLRSPEEMRKPKREAMAALPPICCCCCRLD 104 ++L D SPEE+ +RE ++ P+C CC +D Sbjct: 797 TDLVDNMSPEEIEAWEREQLS--QPVCFDCCCID 828
>KCNKC_HUMAN (Q9HB15) Potassium channel subfamily K member 12 (Tandem pore| domain halothane-inhibited potassium channel 2) (THIK-2) Length = 430 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -1 Query: 187 RSPEEMRKPKREAMAALP--PICCCCCR 110 RSP R P R + LP CCCCCR Sbjct: 4 RSP---RPPPRRSRRRLPRPSCCCCCCR 28
>KCNKC_RAT (Q9ERS1) Potassium channel subfamily K member 12 (Tandem pore| domain halothane-inhibited potassium channel 2) (THIK-2) Length = 430 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -1 Query: 187 RSPEEMRKPKREAMAALP--PICCCCCR 110 RSP R P R LP CCCCCR Sbjct: 4 RSP---RPPPRRCRRRLPRPSCCCCCCR 28 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,784,771 Number of Sequences: 219361 Number of extensions: 352264 Number of successful extensions: 1169 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)