ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet99d01 |
|---|---|
| Clone Library Name | barley_pub |
>POLN_HEVME (Q03495) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1691 Score = 30.4 bits (67), Expect = 1.4 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 3 PAETPKASARHG-DRRPGRRHIPLLPLMPPSPHRSLSFRLL 122 PA+ +A ARHG R H+P L+PP +R+ S+ L+ Sbjct: 171 PADVAEAMARHGMTRLYAAFHLPPEVLLPPGTYRTSSYLLI 211
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch| 3) [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 28.9 bits (63), Expect = 4.0 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 36 GDRRPGRRHIPLLPLMPPSPHRSLSFRLLPGDPGIA 143 G R RR P+ P PP P R+L LL PG A Sbjct: 4 GARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAA 39
>RASA3_BOVIN (Q28013) Ras GTPase-activating protein 3 (GAP1(IP4BP)) (Ins| P4-binding protein) Length = 834 Score = 28.5 bits (62), Expect = 5.3 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 21 ASARHGDRRPGRRHIPLLPLMPPSPHRSLSFRLLPGDPGIARLAPG 158 ++ + GD G +PL L SPH + F L P D G L PG Sbjct: 234 SNLKFGDEFLGELRVPLKVLRQSSPHEAWYF-LQPRDNGSKSLKPG 278
>KCNA5_MOUSE (Q61762) Potassium voltage-gated channel subfamily A member 5| (Voltage-gated potassium channel subunit Kv1.5) (KV1-5) Length = 602 Score = 28.1 bits (61), Expect = 6.9 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 12 TPKASARHGDRRPGRRHIPLLPLMPPSPHR-SLSFRLLPGDPGI 140 +P+ A H D G R +P +P P P R S GDPG+ Sbjct: 50 SPRRRATHEDAAQGGRPLPPMPQELPQPRRPSAEDEEGEGDPGL 93
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 27.7 bits (60), Expect = 9.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 12 TPKASARHGDRRPGRRHIPLLPLMPPSPHRSLSFRL 119 +PK +R + RP P LPL PP P S FRL Sbjct: 1431 SPKNRSRPPEERP-----PGLPLPPPPPSSSAVFRL 1461
>ZCHC2_MOUSE (Q69ZB8) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 1168 Score = 27.7 bits (60), Expect = 9.0 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 11/45 (24%) Frame = +3 Query: 6 AETPKASARHGDRRPGRRH-----------IPLLPLMPPSPHRSL 107 AE P+A AR G + P RR +P P PPSP R L Sbjct: 22 AEEPEADARPGAKAPLRRRRDCRPPPPPTGLPRGPPPPPSPPRGL 66
>HCN4_RABIT (Q9TV66) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Hyperpolarization-activated cation channel 4) (HAC-4) Length = 1175 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 3 PAETPKASARHGDRRPGRRHIPLLPLMPPSPHRSLSFRLLPG 128 P+ P+AS HG P P PP+P R + L PG Sbjct: 1020 PSAPPRASGSHGSLLLPPASSPPPPPPPPAPQRRATPPLAPG 1061
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 27.7 bits (60), Expect = 9.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 12 TPKASARHGDRRPGRRHIPLLPLMPPSPHRSLSFRL 119 +PK +R + RP P LPL PP P S FRL Sbjct: 1438 SPKNRSRPPEERP-----PGLPLPPPPPSSSAVFRL 1468
>BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2157 Score = 27.7 bits (60), Expect = 9.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 12 TPKASARHGDRRPGRRHIPLLPLMPPSPHRSLSFRL 119 +PK +R + RP P LPL PP P S FRL Sbjct: 1435 SPKNRSRPPEERP-----PGLPLPPPPPSSSAVFRL 1465
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 72 LPLMPPSPHRSLSFRLLPGDPGIARL 149 LP PP+ RSL RL P PG+ L Sbjct: 1433 LPASPPAARRSLLHRLPPTAPGVGPL 1458
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 27.7 bits (60), Expect = 9.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 12 TPKASARHGDRRPGRRHIPLLPLMPPSPHRSLSFRL 119 +PK +R + RP P LPL PP P S FRL Sbjct: 1435 SPKNRSRPPEERP-----PGLPLPPPPPSSSAVFRL 1465
>POLN_HEVPA (P33424) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 27.7 bits (60), Expect = 9.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 3 PAETPKASARHG-DRRPGRRHIPLLPLMPPSPHRSLSFRLL 122 P++ +A RHG R H+P L+PP +R+ S+ L+ Sbjct: 171 PSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLI 211
>POLN_HEVMY (Q04610) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 27.7 bits (60), Expect = 9.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 3 PAETPKASARHG-DRRPGRRHIPLLPLMPPSPHRSLSFRLL 122 P++ +A RHG R H+P L+PP +R+ S+ L+ Sbjct: 171 PSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLI 211
>POLN_HEVBU (P29324) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 27.7 bits (60), Expect = 9.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 3 PAETPKASARHG-DRRPGRRHIPLLPLMPPSPHRSLSFRLL 122 P++ +A RHG R H+P L+PP +R+ S+ L+ Sbjct: 171 PSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLI 211
>DNJC1_HUMAN (Q96KC8) DnaJ homolog subfamily C member 1| Length = 554 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 48 PGRRHIPLLPLMPPSPHRSLSFRLL 122 PGRR + L+P PP P L + LL Sbjct: 12 PGRRQLGLVPFPPPPPRTPLLWLLL 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,051,285 Number of Sequences: 219361 Number of extensions: 232242 Number of successful extensions: 1109 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
