| Clone Name | baet99b05 |
|---|---|
| Clone Library Name | barley_pub |
>SUZ2_DROME (P25172) Protein suppressor 2 of zeste (Protein posterior sex| combs) Length = 1368 Score = 31.6 bits (70), Expect = 0.87 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = +1 Query: 190 CEVLDSFSESVEDLAMISSISLLDSSHQLIQKLYRKCWPSNSNSK---LNMHATAKSGGK 360 C + S S A S+ + SSH+ +K + K P ++N K L+ ++++ GK Sbjct: 471 CSSSTNGSSSSLGTADASTSTSTSSSHRKRKKKHSK-EPKDANGKRKKLHAEISSQTDGK 529 Query: 361 SMRVKMALLKPHATDFKRNH 420 M+VK+ H DFKR+H Sbjct: 530 -MKVKITAKPNHKLDFKRSH 548
>PHK_LACLA (Q9CFH4) Probable phosphoketolase (EC 4.1.2.-)| Length = 822 Score = 29.6 bits (65), Expect = 3.3 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = +1 Query: 73 PMLFSSTSDLRIIFFFHGTGEVFSYASR*PV--TLELNRLCCEVLDSFSESVEDLAMISS 246 P LF+ TSD+ I FF G G Y + + ++L EV F +++ED+ I Sbjct: 213 PTLFARTSDVDIRKFFEGLGYSPRYIENDDIHDYMAYHKLAAEV---FDKAIEDIHQIQK 269 Query: 247 ISLLDSSHQ 273 + D+ +Q Sbjct: 270 DAREDNRYQ 278
>AMPN_MOUSE (P97449) Aminopeptidase N (EC 3.4.11.2) (mAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (Membrane protein p161) (CD13 antigen) Length = 965 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -1 Query: 379 PSSPSCSYPQISRLHACSVWNLSYLASIFCTVSE*AGGNCQVS*WMR 239 P PSC+ + S + L+Y+ S F +S + Q+ W R Sbjct: 257 PEDPSCTMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIGIWAR 303
>PPCK_SULTO (Q972S7) Phosphoenolpyruvate carboxykinase [GTP] (EC 4.1.1.32) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 602 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 239 SHPSAYLTVPTSSFRNCTEN 298 SHP+A TVP ++F+N EN Sbjct: 364 SHPNARFTVPLTAFKNLDEN 383
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 4 QGKKRRAPSEPCGGASSTPSPLPP 75 +G++RR+PS P +PSP PP Sbjct: 543 RGRRRRSPSPPPTRRRRSPSPAPP 566
>MAPE_HUMAN (P78395) Melanoma antigen preferentially expressed in tumors| (Preferentially expressed antigen of melanoma) (OPA-interacting protein 4) (OIP4) Length = 509 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 181 RLCCEVLDSFSESVEDLAMISSISLLDSSHQL 276 RLCC+ L F+ ++D+ MI + LDS L Sbjct: 207 RLCCKKLKIFAMPMQDIKMILKMVQLDSIEDL 238
>GRI22_VITVI (Q9M4H4) Ripening-related protein grip22 precursor| Length = 220 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 37 CGGASSTPSPLPP 75 CGG SSTPSP PP Sbjct: 63 CGGNSSTPSPPPP 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,720,214 Number of Sequences: 219361 Number of extensions: 984526 Number of successful extensions: 3232 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3232 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)