| Clone Name | baet99b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 p... | 60 | 1e-09 | 2 | FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 pre... | 56 | 3e-08 | 3 | FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 pre... | 54 | 1e-07 |
|---|
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 60.5 bits (145), Expect = 1e-09 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +2 Query: 173 GYNITKILGEYPEYSQFNKLLTQTRLAQDINKRRTITVLVVANSDMGS 316 G+NIT+IL + PEYS FN L+QT+LA +IN R TITVLV+ N M S Sbjct: 25 GHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSS 72
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 55.8 bits (133), Expect = 3e-08 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +2 Query: 176 YNITKILGEYPEYSQFNKLLTQTRLAQDINKRRTITVLVVANSDMGS 316 +NIT+IL + P+YS FN L+QT+LA +IN R TITVLV+ N M + Sbjct: 26 HNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSA 72
>FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 precursor| Length = 424 Score = 53.5 bits (127), Expect = 1e-07 Identities = 23/47 (48%), Positives = 34/47 (72%) Frame = +2 Query: 176 YNITKILGEYPEYSQFNKLLTQTRLAQDINKRRTITVLVVANSDMGS 316 +N+T++L +P +S F+ LTQT LA +IN+RRTITV V N+ M + Sbjct: 25 HNVTRLLANHPSFSSFSHFLTQTHLADEINRRRTITVCAVDNAAMSA 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,474,216 Number of Sequences: 219361 Number of extensions: 162358 Number of successful extensions: 787 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)