| Clone Name | baet99a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YR660_MIMIV (Q5UR15) Hypothetical protein R660 | 28 | 8.2 | 2 | THG2_WHEAT (P20159) Gamma-2 purothionin | 28 | 8.2 |
|---|
>YR660_MIMIV (Q5UR15) Hypothetical protein R660| Length = 206 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 13 TFHGQNHTF*NHHRS*QLAVQYTGSNSHSGENGGK 117 ++HG NH + HH Y G N ++G N GK Sbjct: 44 SYHGYNHNYEYHH--------YHGYNHYNGYNYGK 70
>THG2_WHEAT (P20159) Gamma-2 purothionin| Length = 47 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -2 Query: 118 PCRHSRRCGCYCLCTALLAATIDGGFRRCGFVR 20 PC + C CL DG FRRC +R Sbjct: 13 PCVSDKNCAQVCLQEGWGGGNCDGPFRRCKCIR 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,986,673 Number of Sequences: 219361 Number of extensions: 239697 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)