| Clone Name | baet98h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | I17RD_BRARE (Q8QHJ9) Interleukin-17 receptor D precursor (IL-17 ... | 27 | 9.6 | 2 | REGB_PSEAE (Q03381) Protein regB | 27 | 9.6 | 3 | GALT2_HUMAN (Q10471) Polypeptide N-acetylgalactosaminyltransfera... | 27 | 9.6 |
|---|
>I17RD_BRARE (Q8QHJ9) Interleukin-17 receptor D precursor (IL-17 receptor D)| (IL-17RD) (Interleukin-17D receptor) (IL-17D receptor) (Similar expression to FGF genes protein) (Sef) Length = 745 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +1 Query: 166 FAPGVTAQTGSCDDALPPELVGNYSGLACSPVWNNFVLRYAQGGDNV 306 F P +T SC+ L P+ L C P W +L +Q G N+ Sbjct: 173 FFPPSFLRTNSCEVLLGPD------NLVCKPFWKPKMLNVSQLGSNL 213
>REGB_PSEAE (Q03381) Protein regB| Length = 75 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 230 ATTPGWPAAPSGIT 271 A TPGWPA P G T Sbjct: 5 AVTPGWPAIPPGAT 18
>GALT2_HUMAN (Q10471) Polypeptide N-acetylgalactosaminyltransferase 2 (EC| 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase 2) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2) (Polypeptide GalNAc transferase 2) (GalNAc-T2) (pp-GaNTase 2) Length = 571 Score = 27.3 bits (59), Expect = 9.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 309 QHVVPALRVPEHEVIPDGAAGQPGVVADELG 217 ++V P LRVP+H+ I GA Q D LG Sbjct: 431 ENVYPELRVPDHQDIAFGALQQGTNCLDTLG 461 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,534,790 Number of Sequences: 219361 Number of extensions: 485134 Number of successful extensions: 1984 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1981 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)