| Clone Name | baet98g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein | 44 | 7e-05 | 2 | 14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor | 42 | 5e-04 | 3 | HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly... | 39 | 0.004 | 4 | CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor ... | 37 | 0.009 | 5 | XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1... | 28 | 5.3 |
|---|
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 44.3 bits (103), Expect = 7e-05 Identities = 22/48 (45%), Positives = 25/48 (52%) Frame = +3 Query: 252 DTLKLGACANXXXXXXXXXXXXXXXXXDKCCSLLGGLADLEAAVCLCT 395 D LKLGAC + CC LLGGL DL+AA+CLCT Sbjct: 264 DALKLGACVDVLGGLIHIGIGGSAKQT--CCPLLGGLVDLDAAICLCT 309
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 41.6 bits (96), Expect = 5e-04 Identities = 23/48 (47%), Positives = 25/48 (52%) Frame = +3 Query: 252 DTLKLGACANXXXXXXXXXXXXXXXXXDKCCSLLGGLADLEAAVCLCT 395 D LKLG CA+ CCSLL GL +LEAAVCLCT Sbjct: 57 DALKLGVCADVLNLVHNVVIGSPPTL--PCCSLLEGLVNLEAAVCLCT 102
>HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly m 1)| Length = 80 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 333 DKCCSLLGGLADLEAAVCLC 392 D CC+L+GGL D+EA VCLC Sbjct: 26 DDCCALIGGLGDIEAIVCLC 45
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 37.4 bits (85), Expect = 0.009 Identities = 20/48 (41%), Positives = 24/48 (50%) Frame = +3 Query: 252 DTLKLGACANXXXXXXXXXXXXXXXXXDKCCSLLGGLADLEAAVCLCT 395 D LKL CA ++CC LL GL DL+AA+CLCT Sbjct: 51 DALKLKVCAKVLGLVKVGLPQY-----EQCCPLLEGLVDLDAALCLCT 93
>XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1.8) (Xylanase| B) (1,4-beta-D-xylan xylanohydrolase B) Length = 592 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 27 TTSASQLKQPGAMAPRTFSAACLLALLVANTFLAGDAC 140 T SAS + PG RT + C+ L A F A AC Sbjct: 2 TISASDYRHPGNFLKRTTALLCVGTALTALAFNASAAC 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,426,884 Number of Sequences: 219361 Number of extensions: 232279 Number of successful extensions: 856 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 856 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)