ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet98f01 |
|---|---|
| Clone Library Name | barley_pub |
>FOXGB_HUMAN (P55315) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (HFK1) Length = 477 Score = 32.3 bits (72), Expect = 0.50 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 36 HHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRGG 140 HHH PPP+ + P PR + + + P P PQ GG Sbjct: 55 HHHPPPPAPQPPPPRAAQQQQ--PPPPPLAPQAGG 87
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 29.3 bits (64), Expect(2) = 0.64 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 48 PPPSIKHPGPRTSGKPRVIPLQPAEMPQ 131 PPP P P TS P PL PA P+ Sbjct: 2353 PPPPPPPPSPSTSSPPPTPPLPPATSPK 2380 Score = 21.2 bits (43), Expect(2) = 0.64 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 11 SPSMDFTVSPPPSP 52 S S+D + PPP P Sbjct: 2342 SSSLDISAQPPPPP 2355
>SF3A1_ARATH (Q8RXF1) Probable splicing factor 3 subunit 1| Length = 785 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 6 PTLPPWILQSHHHRPPPSIKHPG-PRTSGKPRVIPL 110 P PP L + RPPPS ++PG PR G P + P+ Sbjct: 557 PLPPPPNLALNLPRPPPSAQYPGAPRPLGVPMMQPM 592
>PRP3_RAT (P04474) Acidic proline-rich protein PRP33 precursor (Proline-rich| proteoglycan 1) Length = 206 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 36 HHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRGG 140 HHH PPPS GP+TS +P P P +GG Sbjct: 94 HHHGPPPS---GGPQTSSQPG----NPQGPPPQGG 121
>ADA2A_MOUSE (Q01338) Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor)| (Alpha-2A adrenoreceptor) (Alpha-2AAR) Length = 450 Score = 29.6 bits (65), Expect = 3.2 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +3 Query: 33 SHHHRPPPSIKHP--GPRTSGKPRVIPLQPAE-MPQRG 137 S H PP + P GPR GK R ++P + +P+RG Sbjct: 299 SEHAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRG 336
>GSCR1_HUMAN (Q9NZM4) Glioma tumor suppressor candidate region gene 1 protein| Length = 1509 Score = 29.6 bits (65), Expect = 3.2 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 6 PTLPP-WILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRG 137 PTLP +++Q+ PPP+ +P P G P+ PL+P P G Sbjct: 778 PTLPGIFVIQNQLGVPPPA-SNPAPTAPGPPQP-PLRPQSQPPEG 820
>KI3S1_HUMAN (Q14943) Killer cell immunoglobulin-like receptor 3DS1 precursor| (MHC class I NK cell receptor) (Natural killer-associated transcript 10) (NKAT-10) Length = 387 Score = 29.3 bits (64), Expect = 4.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 6 PTLPPWILQSHHHRPPPSIKHPGPRTSGKPRVI 104 P+ P I+ + +HR P + HPGP RVI Sbjct: 109 PSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVI 141
>KI3L1_HUMAN (P43629) Killer cell immunoglobulin-like receptor 3DL1 precursor| (MHC class I NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (HLA-BW4-specific inhibitory NK cell recept Length = 444 Score = 29.3 bits (64), Expect = 4.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 6 PTLPPWILQSHHHRPPPSIKHPGPRTSGKPRVI 104 P+ P I+ + +HR P + HPGP RVI Sbjct: 109 PSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVI 141
>CHER1_VIBCH (Q9KQ06) Chemotaxis protein methyltransferase 1 (EC 2.1.1.80)| Length = 275 Score = 28.9 bits (63), Expect = 5.5 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -2 Query: 367 RMVRFWSA----GQAPYQIGWTVMSA--ARTGPMWYSSLTRSDDPSNFLDAPRA 224 R ++ WSA GQ PY + T++ R G + S+T +D ++ LD RA Sbjct: 103 RPIKIWSAASSSGQEPYSMAMTILEVQQKRPGLLPSVSITATDISASMLDMCRA 156
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 28.9 bits (63), Expect = 5.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 36 HHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRGG 140 HHH PPP+ + P P +P P + A +R G Sbjct: 55 HHHPPPPAPQPPPPPQQQQPPPPPRRGARRRRRRG 89
>SF3B4_HUMAN (Q15427) Splicing factor 3B subunit 4 (Spliceosome-associated| protein 49) (SAP 49) (SF3b50) (Pre-mRNA-splicing factor SF3b 49 kDa subunit) Length = 424 Score = 28.9 bits (63), Expect = 5.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +3 Query: 45 RPPPSIKHPGPRTSGKPRVIPL------QPAEMPQRG 137 RPPP + HPGP G P P P MP G Sbjct: 336 RPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHG 372
>PHC2_MOUSE (Q9QWH1) Polyhomeotic-like protein 2 (mPH2) (Early development| regulatory protein 2) (p36) Length = 850 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 27 LQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQ 131 LQSH P P KHP P+ + + P +PA Q Sbjct: 329 LQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQ 363
>PDE4D_HUMAN (Q08499) cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC| 3.1.4.17) (DPDE3) (PDE43) Length = 809 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 24 ILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMP 128 +L HHH PPP P P+ PLQP P Sbjct: 50 LLHPHHHLPPPPPPSPQPQPQ-----CPLQPPPPP 79
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +3 Query: 6 PTLPPWI----LQSHHHRPPPSIKHPGPRTSGKPRVIPLQP 116 P LPP + Q H +PP + KHP KP P QP Sbjct: 20 PKLPPKVKPPSTQPPHVKPPSTPKHPKDPPHVKPPSTPKQP 60
>PDE4D_RAT (P14270) cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC| 3.1.4.17) (DPDE3) Length = 803 Score = 28.5 bits (62), Expect = 7.2 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 24 ILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMP 128 +L HHH PPP P P+ P PL P P Sbjct: 50 LLHPHHHLPPPPPPSPQPQLQPPPPP-PLPPPPPP 83
>ADA2A_HUMAN (P08913) Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor)| (Alpha-2A adrenoreceptor) (Alpha-2AAR) (Alpha-2 adrenergic receptor subtype C10) Length = 450 Score = 28.5 bits (62), Expect = 7.2 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +3 Query: 33 SHHHRPPPSIKHP--GPRTSGKPRVIPLQPAE-MPQRG 137 S H PP + P GPR GK R ++P + +P+RG Sbjct: 299 SDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRG 336
>TIO_ATHV3 (Q9YJQ8) Protein tio| Length = 269 Score = 28.5 bits (62), Expect = 7.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 3 TPTLPPWILQSHHHRPPPSIKHPGPRTSGKP 95 TP PP + S + PP +++PGP S P Sbjct: 34 TPGTPPGPINSKNEDYPPPLENPGPNKSEGP 64
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1) (Protein| kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 28.5 bits (62), Expect = 7.2 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 6 PTLPPW-ILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPA 119 PTLPP +L RPP + P P +P V+P QPA Sbjct: 960 PTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP-VLPPQPA 997
>LAMBV_CHICK (Q01636) Laminin beta-1 chain variant (Laminin beta-1-2 chain)| (Fragment) Length = 198 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 6 PTLPPWILQSHHHRPPPSIKHPGPRTSGKPRVIPLQP 116 P PP H RP P+ +HP P + P P P Sbjct: 16 PATPPT-----HARPDPTRRHPDPESRAPPHARPRSP 47
>ATS17_HUMAN (Q8TE56) ADAMTS-17 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 17) (ADAM-TS 17) (ADAM-TS17) Length = 1095 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 18 PWILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMP 128 PW ++ PP PGPR +PR P P P Sbjct: 40 PWRVRPDDVHLPPLPAAPGPRRRRRPRTPPAAPRARP 76
>CHD8_HUMAN (Q9HCK8) Chromodomain-helicase-DNA-binding protein 8 (EC 3.6.1.-)| (ATP-dependent helicase CHD8) (CHD-8) (Helicase with SNF2 domain 1) Length = 2302 Score = 28.1 bits (61), Expect = 9.4 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 15/48 (31%) Frame = +3 Query: 24 ILQSHHHRPPP---SIKHPGPRTSGKP------------RVIPLQPAE 122 +L HHH P P HPG R G P R+ PLQP E Sbjct: 2212 MLHHHHHHPHPHHHHHHHPGLRAPGYPSSPVTTASGTTLRLPPLQPEE 2259
>TOP1_DAUCA (P93119) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 790 Score = 28.1 bits (61), Expect = 9.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 33 SHHHRPPPSIKHPGPRTSGKPRVIPLQPAEM 125 SHH R ++ P P TS KPR+I EM Sbjct: 54 SHHIRMGSNLSCPSPYTSPKPRIIKGPEDEM 84
>PO6F2_MOUSE (Q8BJI4) POU domain, class 6, transcription factor 2| Length = 691 Score = 28.1 bits (61), Expect = 9.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 30 QSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMP 128 Q PPP+ +HP P + P+ P P + P Sbjct: 195 QQQQPPPPPTSQHPQPASQAPPQSQPTPPHQPP 227
>PCQAP_HUMAN (Q96RN5) Positive cofactor 2 glutamine/Q-rich-associated protein| (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) Length = 788 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 12 LPPWILQSHH---HRPPPSIKHPGPRTSGKPRVIPLQPAEMP 128 LP + Q HH H+PPP + P P +P +P Q P Sbjct: 286 LPQQLQQMHHTQHHQPPPQPQQP-PVAQNQPSQLPPQSQTQP 326
>AB1IP_BRARE (Q6PFT9) Amyloid beta A4 precursor protein-binding family B member| 1-interacting protein (APBB1-interacting protein 1) Length = 646 Score = 28.1 bits (61), Expect = 9.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 5 PHSPSMDFTVSPPPSPTF 58 P PSMDF PPP P F Sbjct: 467 PPPPSMDFLPPPPPDPMF 484 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,173,256 Number of Sequences: 219361 Number of extensions: 646483 Number of successful extensions: 3522 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3506 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
