| Clone Name | baet98e09 |
|---|---|
| Clone Library Name | barley_pub |
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 73.2 bits (178), Expect = 2e-13 Identities = 42/90 (46%), Positives = 54/90 (60%) Frame = +2 Query: 86 MAALAPTKMLGTRLDFAGSSRYATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAG 265 MA+L ++MLGT L+F SR ++AP A + F+ V+ +S Sbjct: 1 MASLGVSEMLGTPLNFRAVSR--SSAPLASSPSTFKTVALFSKKKPAPAKSKAVSETS-- 56 Query: 266 IDDELAKWYGPDRRIHLPNGLLDRSEVPEY 355 DELAKWYGPDRRI LP+GLLDRSE+PEY Sbjct: 57 --DELAKWYGPDRRIFLPDGLLDRSEIPEY 84
>PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EIICBA component| [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS Length = 631 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 186 IFCAPAVGAAVAYLEEPAKSSRVPSILVGAS 94 IFC PAV A+ + P K + +++ A+ Sbjct: 252 IFCLPAVALAIIHTARPEKKKMISGVMISAA 282
>C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1982 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 352 LRHLRPVKEAVGQVDPPVRAV 290 L HLRP+ EA+ ++ PVR V Sbjct: 847 LNHLRPIPEAISPLNSPVRPV 867
>ALB32_ARATH (Q8L718) Inner membrane ALBINO3-like protein 2, chloroplast| precursor (Ath5) Length = 525 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 1 THHILPSC*AEHAPLLHAPSPS 66 +HH+ PS H+P L +PSPS Sbjct: 23 SHHLKPSSFISHSPPLFSPSPS 44
>DBP5_CRYNE (Q5KBP5) ATP-dependent RNA helicase DBP5 (EC 3.6.1.-)| Length = 546 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 107 WSERAPPLPQAQGWEGEGACSRGACSAQQEG 15 W E AP P GW GA + G+ + +G Sbjct: 63 WGEPAPSAPADNGWADAGASNGGSGANNNDG 93
>ZEP2_MOUSE (Q3UHF7) Human immunodeficiency virus type I enhancer-binding protein| 2 homolog (Myc intron-binding protein 1) (MIBP-1) Length = 2430 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 125 AGCRASWSERAPPLPQAQGWEGEGAC 48 AG RA+WS PPLP + G C Sbjct: 1105 AGLRAAWSSVLPPLPGDDPGKQVGTC 1130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,837,758 Number of Sequences: 219361 Number of extensions: 657158 Number of successful extensions: 2484 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2484 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)