| Clone Name | baet98d08 |
|---|---|
| Clone Library Name | barley_pub |
>GUNA_CELFI (P07984) Endoglucanase A precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) Length = 449 Score = 33.5 bits (75), Expect = 0.20 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 150 GASCWGR--SRRPCPSPAPGLPTVKPTPDANSAPTRTNKP 37 G +C G + P P+P P PT PTP PT T +P Sbjct: 131 GTTCTGTVPTTSPTPTPTPTTPTPTPTPTPTPTPTVTPQP 170
>WRBA_GEOSL (Q74F05) Flavoprotein wrbA| Length = 203 Score = 32.7 bits (73), Expect = 0.35 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +3 Query: 264 LRLYIVFYSMYXXXXXXXXXXXXXXXXXXXXXXXXXRVPETLSAEVLEKM 413 + + IV+YSMY RVPETLS +VLEKM Sbjct: 1 MNVLIVYYSMYGHIHRMAEAVAEGVREVPGAEAVLRRVPETLSPDVLEKM 50
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 32.3 bits (72), Expect = 0.45 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -3 Query: 147 ASCWGRSRRPCPSPAPGLPTVKPTPDANSAPTRT 46 A +G+S+ P P+PAP P PTP AP+ T Sbjct: 329 AELFGKSKSPSPAPAPE-PVTAPTPSPADAPSPT 361
>Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92)| Length = 279 Score = 32.0 bits (71), Expect = 0.59 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P+P PT PTP +PT T P SP Sbjct: 127 PTPTPSP-TPTPSPTPSPTPSPTPTPSPTPSP 157 Score = 31.6 bits (70), Expect = 0.78 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P PSP P PT PTP PT T P SP Sbjct: 41 PTPSPTP-TPTPSPTPTPTPTPTPTPTPTPSP 71 Score = 31.2 bits (69), Expect = 1.0 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 129 SRRPCPSPAPG-LPTVKPTPDANSAPTRTNKPWNSP 25 S P PSP P P+ PTP +PT T P SP Sbjct: 132 SPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSP 167 Score = 31.2 bits (69), Expect = 1.0 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 129 SRRPCPSPAPG-LPTVKPTPDANSAPTRTNKPWNSP 25 S P PSP P P+ PTP +PT T P SP Sbjct: 92 SPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSP 127 Score = 30.8 bits (68), Expect = 1.3 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 7/39 (17%) Frame = -3 Query: 120 PCPSPAPGL-------PTVKPTPDANSAPTRTNKPWNSP 25 P P+P+P L PT PTP +PT T P SP Sbjct: 79 PTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSP 117 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P+P P+ PTP +PT T P SP Sbjct: 147 PTPTPSP-TPSPTPTPSPTPSPTPTPSPTPSP 177 Score = 29.6 bits (65), Expect = 2.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP +PT T P SP Sbjct: 59 PTPTPTP-TPTPSPTPTPALSPTPTPSPTLSP 89 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 45 PTPTPTPS-PTPTPTPTPTPTPTPTPSPTPTP 75 Score = 28.9 bits (63), Expect = 5.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P+P P+ PTP +PT T P +P Sbjct: 107 PTPTPSP-TPSPTPTPSPTPSPTPTPSPTPTP 137 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 129 SRRPCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 S P P+P P PT PTP + PT + P +P Sbjct: 112 SPTPSPTPTPS-PTPSPTPTPSPTPTPSPTPSPTP 145
>WRBA_METAC (P58796) Flavoprotein wrbA| Length = 209 Score = 32.0 bits (71), Expect = 0.59 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = +3 Query: 264 LRLYIVFYSMYXXXXXXXXXXXXXXXXXXXXXXXXXRVPETLSAEVLEKM 413 +++ I+FYSMY +VPETL EVLEKM Sbjct: 2 VKVNIIFYSMYGHVYRMAEAVAAGAREVEGAEVGIYQVPETLPEEVLEKM 51
>NMDE3_HUMAN (Q14957) Glutamate [NMDA] receptor subunit epsilon 3 precursor| (N-methyl D-aspartate receptor subtype 2C) (NR2C) (NMDAR2C) Length = 1233 Score = 32.0 bits (71), Expect = 0.59 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = -3 Query: 138 WGRSRR-----PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 WG RR PCP+P G PTPD P+ T W P Sbjct: 923 WGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTG--WGPP 963
>GP1BA_HUMAN (P07359) Platelet glycoprotein Ib alpha chain precursor| (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (Antigen CD42b-alpha) (CD42b antigen) [Contains: Glycocalicin] Length = 626 Score = 31.6 bits (70), Expect = 0.78 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P PAP + T++PTP + + P T++P SP Sbjct: 391 PVPEPAPNMTTLEPTP-SPTTPEPTSEPAPSP 421
>MANB_CALSA (P22533) Beta-mannanase/endoglucanase A precursor [Includes: Mannan| endo-1,4-beta-mannosidase A (EC 3.2.1.78) (Beta-mannanase) (Endo-1,4-mannanase); Endo-1,4-beta-glucanase (EC 3.2.1.4) (Cellulase)] Length = 1331 Score = 31.6 bits (70), Expect = 0.78 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSPREV 16 P P+P P PTV PTP PT T P +P + Sbjct: 739 PTPTPTP-TPTVTPTPTVTPTPTVTATPTPTPTPI 772 Score = 29.3 bits (64), Expect = 3.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -3 Query: 114 PSPAPGL---PTVKPTPDANSAPTRTNKPWNSP 25 P+P P + PTV PTP + PT T P +P Sbjct: 528 PTPTPTVTPTPTVTPTPTVTATPTPTPTPTPTP 560
>ZMY15_HUMAN (Q9H091) Zinc finger MYND domain-containing protein 15| Length = 703 Score = 31.2 bits (69), Expect = 1.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 108 PAPGLPTVKPTPDANSAPTRTNKPWNSP 25 PAPG P PTP A APTR + P Sbjct: 668 PAPGPPPPSPTPSAPPAPTRRRRGEKKP 695
>GUNA_CALSA (P22534) Endoglucanase A precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase A) (Cellulase A) Length = 1742 Score = 31.2 bits (69), Expect = 1.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 114 PSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P+P P PTV PTP + PT T P ++P Sbjct: 872 PTPTP-TPTVTPTPTVTATPTPTPTPTSTP 900 Score = 31.2 bits (69), Expect = 1.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 114 PSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P+P P PTV PTP + PT T P ++P Sbjct: 661 PTPTP-TPTVTPTPTVTATPTPTPTPTSTP 689 Score = 29.6 bits (65), Expect = 2.9 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -3 Query: 150 GASCWGRS---RRPCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 G WG+ P P+ P PTV PTP PT T P +P Sbjct: 1050 GVLVWGQEPSGATPAPTVTP-TPTVTPTPTPAPTPTATPTPTPTP 1093
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 31.2 bits (69), Expect = 1.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P PSPAP P+ P+P + +P+ + P SP Sbjct: 334 PPPSPAPPTPSPSPSPSPSPSPSPSPSPSPSP 365 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 129 SRRPCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 S P P P+P PT P+P + +P+ + P SP Sbjct: 329 SPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSP 363
>SPKC_SYNY3 (P74745) Serine/threonine-protein kinase C (EC 2.7.11.1)| Length = 535 Score = 30.8 bits (68), Expect = 1.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKP 37 P P P P P+ +PTP + +P T+ P Sbjct: 401 PSPIPTPATPSPEPTPSPSPSPETTSSP 428
>GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E1) (Cellulase E1) (Endocellulase E1) Length = 562 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 135 GRSRRPCPSPAPGL-PTVKPTPDANSAPTRTNKPWNSP 25 G S P P+P + P+ P+P A+ PT T P SP Sbjct: 400 GASASPSSQPSPSVSPSPSPSPSASRTPTPTPTPTASP 437 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -3 Query: 120 PCPSPAPGL---PTVKPTPDANSAPTRT 46 P PSP+P PT PTP A+ PT T Sbjct: 415 PSPSPSPSASRTPTPTPTPTASPTPTLT 442
>IF2_DESVH (Q72ER1) Translation initiation factor IF-2| Length = 1079 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKP 37 P +PAP P VK T A +AP +T +P Sbjct: 160 PAETPAPEAPAVKATVTAEAAPAKTVEP 187
>BAG3_MOUSE (Q9JLV1) BAG family molecular chaperone regulator 3 (BCL-2-binding| athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) Length = 577 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSPRE 19 PCPSP+P P+ P+P N A + P +P E Sbjct: 377 PCPSPSPA-PSAVPSPPKNVAAEQKAAPSPAPAE 409
>ACHD_CHICK (P02717) Acetylcholine receptor protein, delta subunit precursor| Length = 513 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 166 VVAGGWRFLLG--TQPPPLPISGAGFTNSQANPR 71 VV W FL+G PPPLP SG F + N R Sbjct: 478 VVGTLWIFLMGIYNHPPPLPFSGDPFDYREENKR 511
>P53_CANFA (Q29537) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 381 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 11/47 (23%) Frame = -3 Query: 144 SCWGRSRR-----------PCPSPAPGLPTVKPTPDANSAPTRTNKP 37 +C GR RR PCP P PG P +S+P + KP Sbjct: 264 ACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPPSTSSSPPQKKKP 310
>CU086_HUMAN (P59089) Protein C21orf86| Length = 165 Score = 29.6 bits (65), Expect = 2.9 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 7/31 (22%) Frame = -3 Query: 150 GASCWGR-SRRPCPSPA------PGLPTVKP 79 GA CWGR +RRPC P P LP +P Sbjct: 106 GAPCWGRFNRRPCLPPTVLRKDRPSLPQERP 136
>MILK1_MOUSE (Q8BGT6) Molecule interacting with Rab13 (MIRab13) (MICAL-like| protein 1) Length = 870 Score = 29.6 bits (65), Expect = 2.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPW 34 P PSP+P P P P + A ++ PW Sbjct: 445 PVPSPSPAPPVPSPAPAPSEATPKSLHPW 473
>P53_FELCA (P41685) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 386 Score = 29.6 bits (65), Expect = 2.9 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 11/47 (23%) Frame = -3 Query: 144 SCWGRSRR-----------PCPSPAPGLPTVKPTPDANSAPTRTNKP 37 +C GR RR PCP P PG P +S P + KP Sbjct: 269 ACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALPPSTSSTPPQKKKP 315
>RAPH1_HUMAN (Q70E73) Ras-associated and pleckstrin homology domains-containing| protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein) Length = 1302 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P P P PT PTPD + +P + +SP Sbjct: 988 PAPPPPPP-PTASPTPDKSGSPGKKTSKTSSP 1018
>PEVRA_PIG (Q863Y7) Endogenous retrovirus A receptor precursor| Length = 446 Score = 29.3 bits (64), Expect = 3.8 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +2 Query: 2 TLHLTTSRGEFQGLLVLVGAELA-----SGVGLTVGKPGAGDGQGRRLRPQQE 145 T L S FQGLL+L+ + ++ SG GL G PG + + P QE Sbjct: 201 TALLVISAAAFQGLLLLLPSLVSIPTEGSGTGLRGGAPGVEEEEEEEASPLQE 253
>MYO15_MOUSE (Q9QZZ4) Myosin-15 (Myosin XV) (Unconventional myosin-15)| Length = 3511 Score = 29.3 bits (64), Expect = 3.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSPRE 19 P PSP+P P P S P R P+ S R+ Sbjct: 657 PAPSPSPASPLTPPFSPTFSRPPRLASPYGSLRQ 690
>GUNB_CALSA (P10474) Endoglucanase/exoglucanase B precursor [Includes:| Endoglucanase (EC 3.2.1.4) (Endo-1,4-beta-glucanase) (Cellulase) (Cellobiohydrolase); Exoglucanase (EC 3.2.1.91) (Exocellobiohydrolase) (1,4-beta-cellobiohydrolase)] Length = 1039 Score = 29.3 bits (64), Expect = 3.8 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = -3 Query: 120 PCPSPAPGL-----PTVKPTPDANSAPTRTNKPWNSP 25 P P+P P + PT PTP + PT T P ++P Sbjct: 380 PTPTPTPTVTVTPTPTPTPTPTVTATPTPTPTPVSTP 416
>GCNL2_HUMAN (Q92830) General control of amino acid synthesis protein 5-like 2| (EC 2.3.1.48) (Histone acetyltransferase GCN5) (hsGCN5) (STAF97) Length = 837 Score = 29.3 bits (64), Expect = 3.8 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -3 Query: 123 RPCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 RP SPAP PT P P SAP T P +P Sbjct: 17 RPLQSPAPA-PTPTPAPSPASAPIPTPTPAPAP 48
>VTP3_TTV1V (P19275) Viral protein TPX| Length = 474 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 405 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 435 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 395 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 425 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 385 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 415 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 336 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 366 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 326 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 356 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 316 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 346 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 306 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 336 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 296 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 326 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 286 PTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 316 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRTNKPWNSP 25 P P+P P PT PTP PT T P +P Sbjct: 276 PSPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 306
>APA_MYCTU (Q50906) Alanine and proline-rich secreted protein apa precursor| (45/47 kDa antigen) (Fibronectin attachment protein) (Immunogenic protein MPT32) (Antigen MPT-32) (45-kDa glycoprotein) (FAP-B) Length = 325 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRT 46 P P+PAP P P P APT T Sbjct: 291 PAPAPAPAEPAPAPAPAGEVAPTPT 315
>APA_MYCBO (O30620) Alanine and proline-rich secreted protein apa precursor| (Fibronectin attachment protein) (45/47 kDa antigen) (FAP-B) Length = 325 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 120 PCPSPAPGLPTVKPTPDANSAPTRT 46 P P+PAP P P P APT T Sbjct: 291 PAPAPAPAEPAPAPAPAGEVAPTPT 315
>SF04_RAT (Q68FU8) Splicing factor 4| Length = 644 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 117 CPSPAPGLPTVKPTPDANSAPTRT 46 CP+P P V PTP PT T Sbjct: 352 CPTPVAPAPAVNPTPSIPGKPTAT 375
>TNC6B_HUMAN (Q9UPQ9) Trinucleotide repeat-containing 6B protein| Length = 1723 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 132 RSRRPCPSPAPGLPTVKPTPDANSAPTRTNKPWNS 28 R+ P P P PGL KP+ +S R+ + W + Sbjct: 1483 RNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGT 1517
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 135 GRSRRPCPSPAPGLPTVKPTPDANSAPTRTNKP 37 G S +P PSP+P P P P P+ + KP Sbjct: 61 GPSPKPGPSPSPPKPPPSPAPKPVPPPSPSPKP 93
>ZAN_HUMAN (Q9Y493) Zonadhesin precursor| Length = 2812 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 114 PSPAPGLPTVKPTPDANSAPTRTNKPWNSPREV 16 P+ P +PT KPT T T KP SP ++ Sbjct: 741 PTEKPTIPTEKPTISPEKPTTPTEKPTISPEKL 773
>FLIF_AQUAE (O67241) Flagellar M-ring protein| Length = 489 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 132 RSRRPCPSPAPGLPTVKPTPDANSAPTRTNKPWNSPREVVR 10 R R P P+PAP +P V PT + R P+ E+ + Sbjct: 436 RRRPPAPTPAPAVPGVPPTVE----EVRKKTPYEELLEIAK 472
>EXTN_SORBI (P24152) Extensin precursor (Proline-rich glycoprotein)| Length = 283 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 114 PSPAPGLPTVKPTPDANSAPTRTNKP 37 PSP P P P P A++ PT T P Sbjct: 96 PSPKPKSPVYPPPPKASTPPTYTPSP 121
>SF04_MOUSE (Q8CH02) Splicing factor 4| Length = 643 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 117 CPSPAPGLPTVKPTPDANSAPTRT 46 CP+P P V PTP PT T Sbjct: 351 CPTPVAPAPAVNPTPSIPGKPTAT 374
>CLPB2_SYNPX (Q7U3T3) Chaperone clpB 2| Length = 900 Score = 28.5 bits (62), Expect = 6.6 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -3 Query: 126 RRPCPSPAPGLPTVKPTPDANSAPTRTNKPWNSPR 22 R+P SPAP P P P A SAP T + +PR Sbjct: 149 RQPSVSPAPAPP---PVPTAASAPAPTPRSAPAPR 180
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 120 PCPSPA-PGLPTVKPTPDANSAPTRTNKPWNSP 25 PCPSP P PT KP P P P +P Sbjct: 154 PCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAP 186
>PHC1_MOUSE (Q64028) Polyhomeotic-like protein 1 (mPH1) (Early development| regulatory protein 1) (RAE-28) Length = 1012 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -2 Query: 127 PPPLPISGAGFTNSQANPRCQFSSN*DQQTLEFSSGGG 14 P P+SG T+SQA Q SS Q+L S GG Sbjct: 232 PGASPVSGLSQTSSQALAVAQASSGASGQSLNLSQAGG 269
>VPR_HV1A2 (P05952) VPR protein (R ORF protein)| Length = 97 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 416 LHLLQHLRRESLRHPPQDGLHPL 348 L LL+ L+RE++RH P+ LH L Sbjct: 20 LELLEELKREAVRHFPRPWLHSL 42
>YC66L_SYNY3 (Q55823) Ycf66-like protein| Length = 337 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 114 PSPAPGLPTVKPTPDANS--APTRTNKPWNSP 25 P+P+ PT +P P+A + AP+R +P N+P Sbjct: 217 PTPSRRPPTRRPRPEAGNDPAPSRRPRPSNNP 248
>HCN2_HUMAN (Q9UL51) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 2 (Brain cyclic nucleotide gated channel 2) (BCNG-2) Length = 889 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -3 Query: 126 RRPCPSPAPGLPTVKPTPDAN--SAPTRTNKPWNSP 25 RRP P PAP + P P A+ AP P SP Sbjct: 759 RRPPPGPAPAAASPGPPPPASPPGAPASPRAPRTSP 794
>TRPL_DROME (P48994) Transient-receptor-potential-like protein| Length = 1124 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -3 Query: 117 CPSP-----APGLPTVKPTPDANSAPTRTNKP 37 CPS AP PT P A +APT T KP Sbjct: 1027 CPSKLIANSAPSAPTAPPKKSAPTAPTPTYKP 1058 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,821,746 Number of Sequences: 219361 Number of extensions: 729961 Number of successful extensions: 4154 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 3305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4002 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)