| Clone Name | baet98d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRAD1_ECOLI (P09130) Protein traD | 29 | 4.1 | 2 | UL14_VZVD (P09295) Hypothetical gene 46 protein | 28 | 7.0 | 3 | PSAG_HORVU (Q00327) Photosystem I reaction center subunit V, chl... | 28 | 7.0 |
|---|
>TRAD1_ECOLI (P09130) Protein traD| Length = 717 Score = 28.9 bits (63), Expect = 4.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 18 DQGLAARWSLSTHPPTQLQLRRRSEDHGHLHRRR 119 D W HP Q Q++RR E + ++HR R Sbjct: 674 DMAAYEAWQQENHPDIQQQMQRREEVNINVHRER 707
>UL14_VZVD (P09295) Hypothetical gene 46 protein| Length = 199 Score = 28.1 bits (61), Expect = 7.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 18 DQGLAARWSLSTHPPTQLQLR 80 D+ L +W L+THPPT L+ Sbjct: 144 DEALLTQWMLTTHPPTSKYLQ 164
>PSAG_HORVU (Q00327) Photosystem I reaction center subunit V, chloroplast| precursor (PSI-G) (Photosystem I 9 kDa protein) Length = 143 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 97 MATSTAAVLSPPA 135 MATSTAAVLSPPA Sbjct: 1 MATSTAAVLSPPA 13 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,601,071 Number of Sequences: 219361 Number of extensions: 186637 Number of successful extensions: 598 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 80,573,946 effective HSP length: 20 effective length of database: 76,186,726 effective search space used: 1828481424 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)