| Clone Name | baet98a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACTN4_RAT (Q9QXQ0) Alpha-actinin-4 (Non-muscle alpha-actinin 4) ... | 30 | 2.3 | 2 | P49_STRLI (P06108) Protein p49 | 29 | 3.0 |
|---|
>ACTN4_RAT (Q9QXQ0) Alpha-actinin-4 (Non-muscle alpha-actinin 4) (F-actin| cross linking protein) Length = 911 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -2 Query: 116 GGQTDY*AQEK---RAMYVERAWEKQQRR 39 GG DY AQE R + ++ AWEKQQR+ Sbjct: 26 GGMGDYMAQEDDWDRDLLLDPAWEKQQRK 54
>P49_STRLI (P06108) Protein p49| Length = 469 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 5 RATKRPALILIIAAVASPTRVPRTSLVFLA 94 RA +RP LI + +VA PTR P VF A Sbjct: 326 RAPERPFLITVQPSVADPTRAPAGKHVFWA 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,221,478 Number of Sequences: 219361 Number of extensions: 282446 Number of successful extensions: 825 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)